Showing Protein Omega-amidase NIT2 (HMDBP11862)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11862 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Omega-amidase NIT2 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | NIT2 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle. | ||||||||
| Pathways |
|
||||||||
| Reactions |
|
||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 3 | ||||||||
| Locus | 3q12.2 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 30607.645 | ||||||||
| Theoretical pI | 7.212 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|9910460|ref|NP_064587.1| omega-amidase NIT2 [Homo sapiens] MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEK IPGESTQKLS |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q9NQR4 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:29878 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||