| Identification |
| HMDB Protein ID
| HMDBP11879 |
| Secondary Accession Numbers
| None |
| Name
| Geranylgeranyl transferase type-2 subunit beta |
| Synonyms
|
- Geranylgeranyl transferase type II subunit beta
- Rab geranyl-geranyltransferase subunit beta
- Rab geranylgeranyltransferase subunit beta
- Type II protein geranyl-geranyltransferase subunit beta
- GGTase-II-beta
- Rab GG transferase beta
- Rab GGTase beta
|
| Gene Name
| RABGGTB |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.
|
| Pathways
|
Not Available
|
| Reactions
|
| Geranylgeranyl-PP + protein-cysteine → S-geranylgeranyl-protein + Pyrophosphate |
details
|
|
| GO Classification
|
| Biological Process |
| protein geranylgeranylation |
| cellular protein modification process |
| visual perception |
| Molecular Function |
| Rab geranylgeranyltransferase activity |
| metal ion binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 36924.04 |
| Theoretical pI
| 5.034 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|21359854|ref|NP_004573.2| geranylgeranyl transferase type-2 subunit beta [Homo sapiens]
MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLM
GQLHRMNREE
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P53611 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9796 |
| References |
| General References
| Not Available |