| Identification |
| HMDB Protein ID
| HMDBP11881 |
| Secondary Accession Numbers
| None |
| Name
| ATP-dependent DNA helicase PIF1 |
| Synonyms
|
- PIF1/RRM3 DNA helicase-like protein
|
| Gene Name
| PIF1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| DNA-dependent ATPase and DNA helicase inhibiting telomerase activity by unwinding DNA/RNA duplex formed by telomerase RNA and telomeric DNA in a 5' to 3' polarity. Negatively regulates telomere length and such inhibition requires its ATPase activity. Tightly cell cycle regulated and expressed in late S/G2 phase.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| negative regulation of telomerase activity |
| regulation of telomere maintenance |
| Cellular Component |
| nuclear chromosome, telomeric region |
| Molecular Function |
| magnesium ion binding |
| ATP-dependent 5'-3' DNA/RNA helicase activity |
| telomeric DNA binding |
| ATP binding |
| ATP-dependent 5'-3' DNA helicase activity |
| single-stranded DNA-dependent ATP-dependent DNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 15 |
| Locus
| 15q22.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 69797.78 |
| Theoretical pI
| 9.718 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|82546872|ref|NP_079325.2| ATP-dependent DNA helicase PIF1 [Homo sapiens]
MLSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAP
GPAGRPRCFP
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H611 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26220 |
| References |
| General References
| Not Available |