Hmdb loader

Showing Protein Mitochondrial coenzyme A transporter SLC25A42 (HMDBP11930)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 0 metabolites
Identification
HMDB Protein ID HMDBP11930
Secondary Accession Numbers None
Name Mitochondrial coenzyme A transporter SLC25A42
Synonyms
  1. Solute carrier family 25 member 42
Gene Name SLC25A42
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Mitochondrial carrier mediating the transport of coenzyme A (CoA) in mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate.
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
mitochondrion
integral to membrane
mitochondrial inner membrane
Molecular Function
ADP transmembrane transporter activity
AMP transmembrane transporter activity
ATP transmembrane transporter activity
coenzyme A transmembrane transporter activity
adenosine-diphosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19p13.11
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 35408.725
Theoretical pI 10.073
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|258547124|ref|NP_848621.2| mitochondrial coenzyme A transporter SLC25A42 [Homo sapiens]
MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKII
FQVSSKRFSA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q86VD7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:28380
References
General References Not Available