Showing Protein Mitochondrial coenzyme A transporter SLC25A42 (HMDBP11930)
| Identification | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11930 | ||||||||||
| Secondary Accession Numbers | None | ||||||||||
| Name | Mitochondrial coenzyme A transporter SLC25A42 | ||||||||||
| Synonyms |
|
||||||||||
| Gene Name | SLC25A42 | ||||||||||
| Protein Type | Unknown | ||||||||||
| Biological Properties | |||||||||||
| General Function | Not Available | ||||||||||
| Specific Function | Mitochondrial carrier mediating the transport of coenzyme A (CoA) in mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate. | ||||||||||
| Pathways | Not Available | ||||||||||
| Reactions | Not Available | ||||||||||
| GO Classification |
|
||||||||||
| Cellular Location | Not Available | ||||||||||
| Gene Properties | |||||||||||
| Chromosome Location | 19 | ||||||||||
| Locus | 19p13.11 | ||||||||||
| SNPs | Not Available | ||||||||||
| Gene Sequence | Not Available | ||||||||||
| Protein Properties | |||||||||||
| Number of Residues | Not Available | ||||||||||
| Molecular Weight | 35408.725 | ||||||||||
| Theoretical pI | 10.073 | ||||||||||
| Pfam Domain Function | Not Available | ||||||||||
| Signals | Not Available | ||||||||||
| Transmembrane Regions | Not Available | ||||||||||
| Protein Sequence |
>>gi|258547124|ref|NP_848621.2| mitochondrial coenzyme A transporter SLC25A42 [Homo sapiens] MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKII FQVSSKRFSA |
||||||||||
| External Links | |||||||||||
| GenBank ID Protein | Not Available | ||||||||||
| UniProtKB/Swiss-Prot ID | Q86VD7 | ||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
| PDB IDs | Not Available | ||||||||||
| GenBank Gene ID | Not Available | ||||||||||
| GeneCard ID | Not Available | ||||||||||
| GenAtlas ID | Not Available | ||||||||||
| HGNC ID | HGNC:28380 | ||||||||||
| References | |||||||||||
| General References | Not Available | ||||||||||