Showing Protein Zinc transporter ZIP4 (HMDBP11937)
| Identification | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11937 | ||||||||||||
| Secondary Accession Numbers | None | ||||||||||||
| Name | Zinc transporter ZIP4 | ||||||||||||
| Synonyms |
|
||||||||||||
| Gene Name | SLC39A4 | ||||||||||||
| Protein Type | Unknown | ||||||||||||
| Biological Properties | |||||||||||||
| General Function | Not Available | ||||||||||||
| Specific Function | Plays an important role in cellular zinc homeostasis as a zinc transporter. Regulated in response to zinc availability (By similarity). | ||||||||||||
| Pathways |
|
||||||||||||
| Reactions | Not Available | ||||||||||||
| GO Classification |
|
||||||||||||
| Cellular Location | Not Available | ||||||||||||
| Gene Properties | |||||||||||||
| Chromosome Location | 8 | ||||||||||||
| Locus | 8q24.3 | ||||||||||||
| SNPs | Not Available | ||||||||||||
| Gene Sequence | Not Available | ||||||||||||
| Protein Properties | |||||||||||||
| Number of Residues | Not Available | ||||||||||||
| Molecular Weight | 66161.175 | ||||||||||||
| Theoretical pI | 5.51 | ||||||||||||
| Pfam Domain Function | Not Available | ||||||||||||
| Signals | Not Available | ||||||||||||
| Transmembrane Regions | Not Available | ||||||||||||
| Protein Sequence |
>>gi|115430259|ref|NP_060237.2| zinc transporter ZIP4 isoform 1 [Homo sapiens] MVDVVGLERETGPRGSPWPGLPLPSLVGPAPLLTCLCPQCLSVEDALGLGEPEGSGLPPG PVLEARYVAR |
||||||||||||
| External Links | |||||||||||||
| GenBank ID Protein | Not Available | ||||||||||||
| UniProtKB/Swiss-Prot ID | Q6P5W5 | ||||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
| PDB IDs | Not Available | ||||||||||||
| GenBank Gene ID | Not Available | ||||||||||||
| GeneCard ID | Not Available | ||||||||||||
| GenAtlas ID | Not Available | ||||||||||||
| HGNC ID | HGNC:17129 | ||||||||||||
| References | |||||||||||||
| General References | Not Available | ||||||||||||