Hmdb loader
Identification
HMDB Protein ID HMDBP11946
Secondary Accession Numbers None
Name Zinc transporter ZIP13
Synonyms
  1. LIV-1 subfamily of ZIP zinc transporter 9
  2. Solute carrier family 39 member 13
  3. Zrt- and Irt-like protein 13
  4. LZT-Hs9
  5. ZIP-13
Gene Name SLC39A13
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Acts as a zinc-influx transporter.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
connective tissue development
cellular zinc ion homeostasis
Cellular Component
perinuclear region of cytoplasm
integral to Golgi membrane
Molecular Function
zinc ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11p11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 38938.04
Theoretical pI 5.443
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|190014617|ref|NP_001121697.1| zinc transporter ZIP13 isoform a precursor [Homo sapiens]
MPGCPCPGCGMAGPRLLFLTALALELLGRAGGSQPALRSRGTATACRLDNKESESWGALL
SGERLDTWIC
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96H72
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20859
References
General References Not Available