| Identification |
| HMDB Protein ID
| HMDBP11982 |
| Secondary Accession Numbers
| None |
| Name
| E3 ubiquitin/ISG15 ligase TRIM25 |
| Synonyms
|
- Estrogen-responsive finger protein
- RING finger protein 147
- Tripartite motif-containing protein 25
- Ubiquitin/ISG15-conjugating enzyme TRIM25
- Zinc finger protein 147
|
| Gene Name
| TRIM25 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Functions as an ubiquitin E3 ligase and as an ISG15 E3 ligase. Involved in innate immune defense against viruses by mediating ubiquitination of DDX58. Mediates 'Lys-63'-linked polyubiquitination of the DDX58 N-terminal CARD-like region which is crucial for triggering the cytosolic signal transduction that leads to the production of interferons in response to viral infection. Promotes ISGylation of 14-3-3 sigma (SFN), an adapter protein implicated in the regulation of a large spectrum signaling pathway. Mediates estrogen action in various target organs.
|
| Pathways
|
- Influenza A
- NF-kappa B signaling pathway
- protein ubiquitination
- RIG-I-like receptor signaling pathway
|
| Reactions
|
| Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine |
details
|
| Adenosine triphosphate + [ISG15] + [protein]-lysine → Adenosine monophosphate + Pyrophosphate + [protein]-N-ISGyllysine |
details
|
|
| GO Classification
|
| Biological Process |
| defense response to virus |
| innate immune response |
| virus-host interaction |
| negative regulation of type I interferon production |
| Cellular Component |
| cytosol |
| nucleus |
| cell junction |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| sequence-specific DNA binding transcription factor activity |
| ubiquitin-protein ligase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 17 |
| Locus
| 17q23.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 70972.785 |
| Theoretical pI
| 8.096 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|68160937|ref|NP_005073.2| E3 ubiquitin/ISG15 ligase TRIM25 [Homo sapiens]
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQAR
PQLHKNTVLC
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q14258 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:12932 |
| References |
| General References
| Not Available |