Hmdb loader
Identification
HMDB Protein ID HMDBP11991
Secondary Accession Numbers None
Name Ubiquitin-conjugating enzyme E2 R1
Synonyms
  1. Ubiquitin-conjugating enzyme E2-32 kDa complementing
  2. Ubiquitin-conjugating enzyme E2-CDC34
  3. Ubiquitin-protein ligase R1
Gene Name CDC34
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Cooperates with the E2 UBCH5C and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Performs ubiquitin chain elongation building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. UBE2D3 acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Cooperates with the SCF(SKP2) E3 ligase complex to regulate cell proliferation through ubiquitination and degradation of MYBL2 and KIP1. Involved in ubiquitin conjugation and degradation of CREM isoform ICERIIgamma and ATF15 resulting in abrogation of ICERIIgamma- and ATF5-mediated repression of cAMP-induced transcription during both meiotic and mitotic cell cycles. Involved in the regulation of the cell cycle G2/M phase through its targeting of the WEE1 kinase for ubiquitination and degradation. Also involved in the degradation of beta-catenin. Is target of human herpes virus 1 protein ICP0, leading to ICP0-dependent dynamic interaction with proteasomes.
Pathways
  • Herpes simplex virus 1 infection
  • protein ubiquitination
  • Ubiquitin mediated proteolysis
Reactions
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine details
GO Classification
Biological Process
G1/S transition of mitotic cell cycle
DNA replication initiation
negative regulation of cAMP-mediated signaling
proteasomal ubiquitin-dependent protein catabolic process
protein K48-linked ubiquitination
Cellular Component
cytoplasm
nucleus
Molecular Function
ATP binding
ubiquitin-protein ligase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19p13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 26736.515
Theoretical pI 4.537
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|16357477|ref|NP_004350.1| ubiquitin-conjugating enzyme E2 R1 [Homo sapiens]
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA
RLKFPIDYPY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P49427
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:1734
References
General References Not Available