| Identification |
| HMDB Protein ID
| HMDBP11992 |
| Secondary Accession Numbers
| None |
| Name
| Ubiquitin-conjugating enzyme E2 H |
| Synonyms
|
- UbcH2
- Ubiquitin carrier protein H
- Ubiquitin-conjugating enzyme E2-20K
- Ubiquitin-protein ligase H
|
| Gene Name
| UBE2H |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Capable, in vitro, to ubiquitinate histone H2A.
|
| Pathways
|
- protein ubiquitination
- Ubiquitin mediated proteolysis
|
| Reactions
|
| Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine |
details
|
|
| GO Classification
|
| Biological Process |
| protein K48-linked ubiquitination |
| ubiquitin-dependent protein catabolic process |
| protein K11-linked ubiquitination |
| Molecular Function |
| ubiquitin-protein ligase activity |
| ATP binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 7 |
| Locus
| 7q32 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 12859.03 |
| Theoretical pI
| 4.213 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|321267500|ref|NP_001189427.1| ubiquitin-conjugating enzyme E2 H isoform 3 [Homo sapiens]
MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMY
LHRPEEYKQK
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P62256 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:12484 |
| References |
| General References
| Not Available |