| Identification |
| HMDB Protein ID
| HMDBP12002 |
| Secondary Accession Numbers
| None |
| Name
| Vascular non-inflammatory molecule 2 |
| Synonyms
|
- Vanin-2
- Glycosylphosphatidyl inositol-anchored protein GPI-80
- Protein FOAP-4
|
| Gene Name
| VNN2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. Involved in the thymus homing of bone marrow cells. May regulate beta-2 integrin-mediated cell adhesion, migration and motility of neutrophil.
|
| Pathways
|
- Pantothenate and CoA biosynthesis
|
| Reactions
|
| Pantetheine + Water → Pantothenic acid + Cysteamine |
details
|
|
| GO Classification
|
| Biological Process |
| cellular component movement |
| pantothenate metabolic process |
| nitrogen compound metabolic process |
| Cellular Component |
| anchored to membrane |
| plasma membrane |
| Molecular Function |
| hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides |
| pantetheine hydrolase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6q23-q24 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 33256.93 |
| Theoretical pI
| 6.121 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|334278906|ref|NP_001229279.1| vascular non-inflammatory molecule 2 isoform 3 precursor [Homo sapiens]
MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDI
LETAIKQAAE
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O95498 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:12706 |
| References |
| General References
| Not Available |