Showing Protein Zinc transporter 9 (HMDBP12043)
| Identification | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP12043 | ||||||||||||
| Secondary Accession Numbers | None | ||||||||||||
| Name | Zinc transporter 9 | ||||||||||||
| Synonyms |
|
||||||||||||
| Gene Name | SLC30A9 | ||||||||||||
| Protein Type | Unknown | ||||||||||||
| Biological Properties | |||||||||||||
| General Function | Not Available | ||||||||||||
| Specific Function | Plays a role in the p160 coactivator signaling pathway that mediates transcriptional activation by nuclear receptors (By similarity). Plays a role in transcriptional activation of Wnt-responsive genes (By similarity). | ||||||||||||
| Pathways | Not Available | ||||||||||||
| Reactions | Not Available | ||||||||||||
| GO Classification |
|
||||||||||||
| Cellular Location | Not Available | ||||||||||||
| Gene Properties | |||||||||||||
| Chromosome Location | 4 | ||||||||||||
| Locus | 4p13 | ||||||||||||
| SNPs | Not Available | ||||||||||||
| Gene Sequence | Not Available | ||||||||||||
| Protein Properties | |||||||||||||
| Number of Residues | Not Available | ||||||||||||
| Molecular Weight | 63514.525 | ||||||||||||
| Theoretical pI | 8.33 | ||||||||||||
| Pfam Domain Function | Not Available | ||||||||||||
| Signals | Not Available | ||||||||||||
| Transmembrane Regions | Not Available | ||||||||||||
| Protein Sequence |
>>gi|57164948|ref|NP_006336.3| zinc transporter 9 [Homo sapiens] MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNMVPCSHPYIGT LSQVKLYSTN |
||||||||||||
| External Links | |||||||||||||
| GenBank ID Protein | Not Available | ||||||||||||
| UniProtKB/Swiss-Prot ID | Q6PML9 | ||||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
| PDB IDs | |||||||||||||
| GenBank Gene ID | Not Available | ||||||||||||
| GeneCard ID | Not Available | ||||||||||||
| GenAtlas ID | Not Available | ||||||||||||
| HGNC ID | HGNC:1329 | ||||||||||||
| References | |||||||||||||
| General References | Not Available | ||||||||||||