| Version |
2.5 |
| Creation Date |
2006-05-22 16:12:43 |
| Update Date |
2009-10-22 17:42:21 |
| Accession Number |
HMDB03229 |
| Secondary Accession Numbers |
Not Available |
| Common Name |
Palmitoleic acid |
| Description |
fatty acids, Monounsaturated
Palmitoleic acid, or 9-hexadecenoic acid, is an unsaturated fatty acid that is a common constituent of the glycerides of human adipose tissue. Present in all tissues, generally found in higher concentrations in the liver. Macadamia oil (Macadamia integrifolia) and Sea Buckthorn oil (Hippophae rhamnoides) are botanical sources of palmitoleic acid, containing 22 and 40% respectively. -- Wikipedia |
| Synonyms |
- (Z)-9-Hexadecenoate
- (Z)-9-Hexadecenoic acid
- (Z)-Hexadec-9-enoate
- (Z)-Hexadec-9-enoic acid
- 9-Hexadecenoate
- 9-Hexadecenoic acid
- 9-cis-Hexadecenoate
- 9-cis-Hexadecenoic acid
- Oleopalmitate
- Oleopalmitic acid
- Palmitoleate
- Palmitoleic acid
- Zoomerate
- Zoomeric acid
- cis-9-Hexadecenoate
- cis-9-Hexadecenoic acid
- cis-Palmitoleate
- cis-Palmitoleic acid
- cis-delta-9-Hexadecenoate
- cis-delta-9-Hexadecenoic acid
- Hexadecenoate
- Hexadecenoic acid
|
| Chemical IUPAC Name |
(E)-hexadec-9-enoic acid |
| Chemical Formula |
C16H30O2 |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
|
| Class |
|
| Sub Class |
|
| Family |
|
| Species |
|
| Biofunction |
| — |
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
254.408 |
| Monoisotopic Molecular Weight |
254.224579 |
| Isomeric SMILES |
CCCCCCC=C/CCCCCCCC(O)=O |
| Canonical SMILES |
CCCCCCC=CCCCCCCCC(O)=O |
| KEGG Compound ID |
C08362  |
| BioCyc ID |
CPD-724  |
| BiGG ID |
246167  |
| Wikipedia Link |
Palmitoleic acid  |
| NuGOwiki Link |
HMDB03229  |
| Metagene Link |
HMDB03229  |
| METLIN ID |
188  |
| PubChem Compound |
5282745  |
| PubChem Substance |
10520683  |
| ChEBI ID |
28716  |
| CAS Registry Number |
373-49-9 |
| InChI Identifier |
InChI=1/C16H30O2/c1-2-3-4-5-6-7-8-9-10-11-12-13-14-15-16(17)18/h7-8H,2-6,9-15H2,1H3,(H,17,18)/b8-7- |
| Synthesis Reference |
Xu, Huashun; Luo, Yuping; Li, Siguang. Palmitoleic acid production by fermentation with yeast. Zhongguo Youzhi (1999), 24(6), 53-55. |
| Melting Point (Experimental) |
-0.1 oC |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
0.000429 mg/mL at 25 oC [MEYLAN,WM et al. (1996)]; 4.47e-04 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
-1 |
| State |
Liquid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
6.71 [Predicted by ALOGPS]; 5.577 [Predicted by PubChem via XLOGP]; 6.75 [MEYLAN,WM & HOWARD,PH (1995)]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
|
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Not Available |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Not Available |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
Not Available |
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
- Membrane (Predicted from LogP)
|
| Biofluid Location |
- Blood
- Cerebrospinal Fluid
- Urine
|
| Tissue Location |
| Tissue |
References |
| Adipose Tissue |
— |
| Skeletal Muscle |
— |
|
| Concentrations (Normal) |
| Biofluid |
Blood |
| Value |
31.0 (5.0-85.0) uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Hoffmann GF, Meier-Augenstein W, Stockler S, Surtees R, Rating D, Nyhan WL: Physiology and pathophysiology of organic acids in cerebrospinal fluid. J Inherit Metab Dis. 1993;16(4):648-69. [PubMed
]
|
| Biofluid |
Blood |
| Value |
4.5 +/- 2.8 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Adults |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 165-177. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
|
| Biofluid |
Blood |
| Value |
6.390 +/- 4.279 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Wishart DS, Lewis MJ, Morrissey JA, Flegel MD, Jeroncic K, Xiong Y, Cheng D, Eisner R, Gautam B, Tzur D, Sawhney S, Bamforth F, Greiner R, Li L: The human cerebrospinal fluid metabolome. J Chromatogr B Analyt Technol Biomed Life Sci. 2008 Aug 15;871(2):164-173. Epub 2008 May 8. [PubMed
]
- Wishart DS, Knox C, Guo AC, Eisner R, Young N, Gautam B, Hau DD, Psychogios N, Dong E, Bouatra S, Mandal R, Sinelnikov I, Xia J, Jia L, Cruz JA, Lim E, Sobsey CA, Shrivastava S, Huang P, Liu P, Fang L, Peng J, Fradette R, Cheng D, Tzur D, Clements M, Lewis A, De Souza A, Zuniga A, Dawe M, Xiong Y, Clive D, Greiner R, Nazyrova A, Shaykhutdinov R, Li L, Vogel HJ, Forsythe I: HMDB: a knowledgebase for the human metabolome. Nucleic Acids Res. 2008 Oct 25. [PubMed
]
|
| Biofluid |
CSF |
| Value |
2.0 +/- 2.0 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Hoffmann GF, Meier-Augenstein W, Stockler S, Surtees R, Rating D, Nyhan WL: Physiology and pathophysiology of organic acids in cerebrospinal fluid. J Inherit Metab Dis. 1993;16(4):648-69. [PubMed
]
|
| Biofluid |
Urine |
| Value |
0.03 +/- 0.02 umol/mmol creatinine |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 130. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp. Basel, Switzerland c1981-1992.
|
|
| Concentrations (Abnormal) |
Not Available |
| Associated Disorders |
Not Available |
| OMIM ID |
Not Available |
| Pathways |
Not Available
|
| General References |
- Katsuta Y, Iida T, Inomata S, Denda M: Unsaturated fatty acids induce calcium influx into keratinocytes and cause abnormal differentiation of epidermis. J Invest Dermatol. 2005 May;124(5):1008-13. [PubMed
]
- Rossner S, Walldius G, Bjorvell H: Fatty acid composition in serum lipids and adipose tissue in severe obesity before and after six weeks of weight loss. Int J Obes. 1989;13(5):603-12. [PubMed
]
- Ho RC, Davy KP, Hickey MS, Summers SA, Melby CL: Behavioral, metabolic, and molecular correlates of lower insulin sensitivity in Mexican-Americans. Am J Physiol Endocrinol Metab. 2002 Oct;283(4):E799-808. [PubMed
]
- Hori Y, Nakamura K, Yamamoto M, Shimada K, Nakadaira H, Shibuya N, Endoh K, Ogoshi K: Determination of free fatty acids in human bile by high-performance liquid chromatography. Ann Clin Biochem. 1998 Mar;35 ( Pt 2):279-82. [PubMed
]
- Yli-Jama P, Haugen TS, Rebnord HM, Ringstad J, Pedersen JI: Selective mobilisation of fatty acids from human adipose tissue. Eur J Intern Med. 2001 Apr;12(2):107-115. [PubMed
]
- Prandota J: Clinical pharmacology of antibiotics and other drugs in cystic fibrosis. Drugs. 1988 May;35(5):542-78. [PubMed
]
- Wikipedia

|
| Metabolic Enzymes |
- Thioesterase domain containing 1
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
8493 |
| Enzyme 1 Name |
Thioesterase domain containing 1 |
| Enzyme 1 Synonyms |
Not Available |
| Enzyme 1 Gene Name |
THEDC1 |
| Enzyme 1 Protein Sequence |
>Thioesterase domain containing 1
MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRL
PGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQP
EPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPII
RADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYL
LDPANEKLIKNYIIKCLEVSSISNF
|
| Enzyme 1 Number of Residues |
265 |
| Enzyme 1 Molecular Weight |
29931 |
| Enzyme 1 Theoretical pI |
6.17 |
| Enzyme 1 GO Classification |
| Function |
- CoA hydrolase activity
- acyl-CoA thioesterase II activity
- acyl-CoA thioesterase activity
- catalytic activity
- hydrolase activity
- hydrolase activity, acting on ester bonds
- thiolester hydrolase activity
|
| Process |
- biosynthesis
- metabolism
- physiological process
|
| Component |
| — |
|
| Enzyme 1 General Function |
Secondary metabolites biosynthesis, transport and catabolism |
| Enzyme 1 Specific Function |
Not Available |
| Enzyme 1 Pathways |
Not Available |
| Enzyme 1 Reactions |
Not Available |
| Enzyme 1 Pfam Domain Function |
|
| Enzyme 1 Signals |
Not Available |
| Enzyme 1 Transmembrane Regions |
Not Available |
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
Not Available |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
Q5VUB6  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
Q5VUB6_HUMAN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
Not Available |
| Enzyme 1 GenBank Gene ID |
AL590365  |
| Enzyme 1 GeneCard ID |
OLAH  |
| Enzyme 1 GenAtlas ID |
OLAH  |
| Enzyme 1 HGNC ID |
HGNC:25625  |
| Enzyme 1 Chromosome Location |
10 |
| Enzyme 1 Locus |
10p13 |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
Not Available |
| Enzyme 1 Metabolite References |
Not Available |