You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00272
Secondary Accession Numbers
  • 5504
  • HMDBP03762
Name Catechol O-methyltransferase
Synonyms Not Available
Gene Name COMT
Protein Type Unknown
Biological Properties
General Function Involved in magnesium ion binding
Specific Function Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Pathways
  • Alkaptonuria
  • Disulfiram Action Pathway
  • Dopamine beta-hydroxylase deficiency
  • Dopaminergic synapse
  • Estrone Metabolism
  • Hawkinsinuria
  • Monoamine oxidase-a deficiency (MAO-A)
  • Phenytoin (Antiarrhythmic) Action Pathway
  • Steroid hormone biosynthesis
  • Tyrosine Metabolism
  • Tyrosine metabolism
  • Tyrosinemia Type I
  • Tyrosinemia, transient, of the newborn
Reactions
S-Adenosylmethionine + a catechol → S-Adenosylhomocysteine + a guaiacol details
S-Adenosylmethionine + Norepinephrine → S-Adenosylhomocysteine + Normetanephrine details
S-Adenosylmethionine + Epinephrine → S-Adenosylhomocysteine + Metanephrine details
S-Adenosylmethionine + 3,4-Dihydroxybenzeneacetic acid → S-Adenosylhomocysteine + Homovanillic acid details
S-Adenosylmethionine + Dopamine → S-Adenosylhomocysteine + 3-Methoxytyramine details
2-Hydroxyestrone + S-Adenosylmethionine → 2-Methoxyestrone + S-Adenosylhomocysteine details
2-Hydroxyestradiol + S-Adenosylmethionine → 2-Methoxyestradiol + S-Adenosylhomocysteine details
S-Adenosylmethionine + 3,4-Dihydroxyphenylglycol → S-Adenosylhomocysteine + Vanylglycol details
S-Adenosylmethionine + 3,4-Dihydroxymandelic acid → S-Adenosylhomocysteine + Vanillylmandelic acid details
3,4-Dihydroxy-trans-cinnamate → trans-Ferulic acid details
4-ethenylbenzene-1,2-diol → 2-Methoxy-4-vinylphenol details
3,4-Dihydroxyhydrocinnamic acid → Hydroferulic acid details
4-Ethyl-1,2-benzenediol → 4-Ethyl-2-methoxyphenol details
Protocatechuic acid → Vanillic acid details
Pyrocatechol → Guaiacol details
m-Trigallic acid → 3,4-dihydroxy-5-[3-hydroxy-4-methoxy-5-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]benzoic acid details
m-Trigallic acid → 3-[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]-5-hydroxy-4-methoxybenzoic acid details
3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoic acid → 3-hydroxy-4-methoxy-5-(3,4,5-trihydroxybenzoyloxy)benzoic acid details
3-[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]-2,4,5-trihydroxybenzoic acid → 2,4,5-trihydroxy-3-[3-hydroxy-4-methoxy-5-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]benzoic acid details
3-[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]-2,4,5-trihydroxybenzoic acid → 3-[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]-2,5-dihydroxy-4-methoxybenzoic acid details
3,4-dihydroxy-5-[2,4,5-trihydroxy-3-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]benzoic acid → 3-[2,5-dihydroxy-4-methoxy-3-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]-4,5-dihydroxybenzoic acid details
3,4-dihydroxy-5-[2,4,5-trihydroxy-3-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]benzoic acid → 3-hydroxy-4-methoxy-5-[2,4,5-trihydroxy-3-(3,4,5-trihydroxybenzoyloxy)benzoyloxy]benzoic acid details
3-[3,4-dihydroxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)benzoyloxy]-4,5-dihydroxybenzoic acid → 3,4-dihydroxy-5-[3-hydroxy-4-methoxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)benzoyloxy]benzoic acid details
3-[3,4-dihydroxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)benzoyloxy]-4,5-dihydroxybenzoic acid → 3-[3,4-dihydroxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)benzoyloxy]-5-hydroxy-4-methoxybenzoic acid details
2,4,5-trihydroxy-3-(3,4,5-trihydroxybenzoyloxy)benzoic acid → 2,5-dihydroxy-4-methoxy-3-(3,4,5-trihydroxybenzoyloxy)benzoic acid details
3,4-dihydroxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)benzoic acid → 3-hydroxy-4-methoxy-5-(2,3,4,5-tetrahydroxybenzoyloxy)benzoic acid details
6-[(E)-2-(4-hydroxyphenyl)ethenyl]benzene-1,2,4-triol → 5-[(E)-2-(4-hydroxyphenyl)ethenyl]-4-methoxybenzene-1,3-diol details
3,3',4'5-Tetrahydroxystilbene → 5-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]benzene-1,3-diol details
Swertiajaponin → 6-beta-D-Glucopyranosyl-4',5-dihydroxy-3',7-dimethoxyflavone details
5-hydroxy-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-5-hydroxy-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one details
2'-Hydroxyisoorientin → 2-(2,5-dihydroxy-4-methoxyphenyl)-5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one details
3-(4,5-dihydroxy-2,3-dimethoxyphenyl)prop-2-enal → 3-(4-hydroxy-2,3,5-trimethoxyphenyl)prop-2-enal details
3-(4,5-dihydroxy-2,3-dimethoxyphenyl)propanal → 3-(4-hydroxy-2,3,5-trimethoxyphenyl)propanal details
5-(3-hydroxyprop-1-en-1-yl)-3,4-dimethoxybenzene-1,2-diol → 4-(3-hydroxyprop-1-en-1-yl)-2,3,6-trimethoxyphenol details
Patuletin → Spinacetin details
3-(3,4-dihydroxy-5-methoxyphenyl)-1-(2,4,6-trihydroxy-3-methoxyphenyl)propane-1,2-dione → 3-(4-hydroxy-3,5-dimethoxyphenyl)-1-(2,4,6-trihydroxy-3-methoxyphenyl)propane-1,2-dione details
6-[(E)-2-(4-hydroxyphenyl)ethenyl]-3-[(1E)-3-methylbut-1-en-1-yl]benzene-1,2,4-triol → 5-[(E)-2-(4-hydroxyphenyl)ethenyl]-4-methoxy-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol details
5-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol → 5-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol details
5-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2-[(1E)-3-hydroxy-3-methylbut-1-en-1-yl]benzene-1,3-diol → 5-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]-2-[(1E)-3-hydroxy-3-methylbut-1-en-1-yl]benzene-1,3-diol details
6-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-3-[(1E)-3-methylbut-1-en-1-yl]benzene-1,2,4-triol → 6-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]-3-[(1E)-3-methylbut-1-en-1-yl]benzene-1,2,4-triol details
5-[(E)-2-{3,5-dihydroxy-4-[(1E)-3-methylbut-1-en-1-yl]phenyl}ethenyl]benzene-1,2,4-triol → 5-[(E)-2-(2,5-dihydroxy-4-methoxyphenyl)ethenyl]-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol details
5-[3-(3,4-dihydroxyphenyl)oxiran-2-yl]-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol → 5-[3-(4-hydroxy-3-methoxyphenyl)oxiran-2-yl]-2-[(1E)-3-methylbut-1-en-1-yl]benzene-1,3-diol details
5-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2-[3-(propan-2-yl)oxiran-2-yl]benzene-1,3-diol → 5-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]-2-[3-(propan-2-yl)oxiran-2-yl]benzene-1,3-diol details
5-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2-[(1E)-4-hydroxy-3-methylbut-1-en-1-yl]benzene-1,3-diol → 5-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]-2-[(1E)-4-hydroxy-3-methylbut-1-en-1-yl]benzene-1,3-diol details
5-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2-[(1E)-3-methylbuta-1,3-dien-1-yl]benzene-1,3-diol → 5-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]-2-[(1E)-3-methylbuta-1,3-dien-1-yl]benzene-1,3-diol details
3-(3,4-dihydroxyphenyl)-11,19-bis(4-hydroxyphenyl)-4,12,20-trioxaheptacyclo[16.6.1.1²,⁵.1¹⁰,¹³.0²¹,²⁵.0⁹,²⁷.0¹⁷,²⁶]heptacosa-1(25),5,7,9(27),13,15,17(26),21,23-nonaene-7,15,23-triol → 3-(4-hydroxy-3-methoxyphenyl)-11,19-bis(4-hydroxyphenyl)-4,12,20-trioxaheptacyclo[16.6.1.1²,⁵.1¹⁰,¹³.0²¹,²⁵.0⁹,²⁷.0¹⁷,²⁶]heptacosa-1(25),5,7,9(27),13,15,17(26),21,23-nonaene-7,15,23-triol details
Xanthochymuside → 5,7-dihydroxy-3-[5-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-7-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one details
Dihydromorelloflavone → 3-[5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-5,7-dihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one details
3-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-5,7-dihydroxy-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-one → 3-[5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-5,7-dihydroxy-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-one details
Orientin → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one details
2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → 5,6,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one details
1-(3,4-dihydroxyphenyl)-3-(4-methoxy-1-benzofuran-5-yl)propane-1,3-dione → 1-(4-hydroxy-3-methoxyphenyl)-3-(4-methoxy-1-benzofuran-5-yl)propane-1,3-dione details
Quercetagitrin → Quercetagetin 3'-methylether 7-glucoside details
3,5,6,7-tetrahydroxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-3,5,6,7-tetrahydroxy-4H-chromen-4-one details
3,5,6,7-tetrahydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-3,5,6,7-tetrahydroxy-3,4-dihydro-2H-1-benzopyran-4-one details
1-(2,3,4,6-tetrahydroxyphenyl)-3-(2,4,5-trihydroxyphenyl)propane-1,2-dione → 3-(2,5-dihydroxy-4-methoxyphenyl)-1-(2,3,4,6-tetrahydroxyphenyl)propane-1,2-dione details
3-(3,7-dimethylocta-2,6-dien-1-yl)-7-hydroxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-7-hydroxy-4H-chromen-4-one details
3-(3,7-dimethylocta-2,6-dien-1-yl)-7-hydroxy-8-(3-methylbut-2-en-1-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-7-hydroxy-8-(3-methylbut-2-en-1-yl)-4H-chromen-4-one details
3-(3,7-dimethylocta-2,6-dien-1-yl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4H-chromen-4-one details
3-(3,7-dimethylocta-2,6-dien-1-yl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one details
3-(3,7-dimethylocta-2,6-dien-1-yl)-5-hydroxy-8,8-dimethyl-2-(2,4,5-trihydroxyphenyl)-4H,8H-pyrano[3,2-g]chromen-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-5-hydroxy-8,8-dimethyl-4H,8H-pyrano[3,2-g]chromen-4-one details
5-[2-(3-hydroxyphenyl)ethyl]-3-methoxybenzene-1,2-diol → 5-[2-(3-hydroxyphenyl)ethyl]-2,3-dimethoxyphenol details
3-[2-(3-hydroxyphenyl)ethyl]-5-methoxybenzene-1,2-diol → 3-[2-(3-hydroxyphenyl)ethyl]-2,5-dimethoxyphenol details
4-[2-(3-hydroxy-5-methoxyphenyl)ethyl]benzene-1,2-diol → 4-[2-(3-hydroxy-5-methoxyphenyl)ethyl]-2-methoxyphenol details
3-[2-(3-hydroxy-5-methoxyphenyl)ethyl]benzene-1,2-diol → 3-[2-(3-hydroxy-5-methoxyphenyl)ethyl]-2-methoxyphenol details
3-methoxy-4-[(2E)-3-phenylprop-2-en-1-yl]benzene-1,2-diol → 2,3-dimethoxy-4-[(2E)-3-phenylprop-2-en-1-yl]phenol details
4-methoxy-5-(3-phenylprop-2-en-1-yl)benzene-1,2-diol → 2,5-dimethoxy-4-[(2E)-3-phenylprop-2-en-1-yl]phenol details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-1λ⁴-chromen-1-ylium → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-1λ⁴-chromen-1-ylium details
2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-1λ⁴-chromen-1-ylium → 3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-1λ⁴-chromen-1-ylium details
2-(3,4-dihydroxyphenyl)-3,5,6,7-tetrahydroxy-1λ⁴-chromen-1-ylium → 3,5,6,7-tetrahydroxy-2-(4-hydroxy-3-methoxyphenyl)-1λ⁴-chromen-1-ylium details
3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-1λ⁴-chromen-1-ylium → 2-(2,5-dihydroxy-4-methoxyphenyl)-3,5,7-trihydroxy-1λ⁴-chromen-1-ylium details
2-(2,4,5-trihydroxyphenyl)acetic acid → 2-(2,5-dihydroxy-4-methoxyphenyl)acetic acid details
2,4,5-trihydroxybenzoic acid → 2,5-dihydroxy-4-methoxybenzoic acid details
3-(3,4-dihydroxyphenyl)-1-(2,4,6-trihydroxy-3,5-dimethoxyphenyl)prop-2-en-1-one → 3-(4-hydroxy-3-methoxyphenyl)-1-(2,4,6-trihydroxy-3,5-dimethoxyphenyl)prop-2-en-1-one details
3-(3,4-dihydroxyphenyl)-1-(2,4,6-trihydroxy-3,5-dimethoxyphenyl)propan-1-one → 3-(4-hydroxy-3-methoxyphenyl)-1-(2,4,6-trihydroxy-3,5-dimethoxyphenyl)propan-1-one details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one details
3-methoxy-5-[7-methoxy-3-methyl-5-(prop-1-en-1-yl)-2,3-dihydro-1-benzofuran-2-yl]benzene-1,2-diol → 2,6-dimethoxy-4-[7-methoxy-3-methyl-5-(prop-1-en-1-yl)-2,3-dihydro-1-benzofuran-2-yl]phenol details
3-(7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl)-6-methoxybenzene-1,2-diol → (R)-3',7-Dihydroxy-2',4'-dimethoxyisoflavan details
4-(7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl)-3-methoxybenzene-1,2-diol → (±)-Sphaerosin details
Isocarlinoside → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one details
26-hydroxyhexacosyl 3-(3,4-dihydroxyphenyl)prop-2-enoate → 26-hydroxyhexacosyl 3-(4-hydroxy-3-methoxyphenyl)prop-2-enoate details
26-hydroxyhexacosyl (2E)-3-(3,4-dihydroxyphenyl)prop-2-enoate → 26-hydroxyhexacosyl (2E)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enoate details
6-[(E)-2-(3,4-dihydroxy-5-methoxyphenyl)ethenyl]-4-methoxy-2H-pyran-2-one → 6-[(E)-2-(4-hydroxy-3,5-dimethoxyphenyl)ethenyl]-4-methoxy-2H-pyran-2-one details
4,6-dimethoxy-3-methylbenzene-1,2-diol → 2,3,5-trimethoxy-6-methylphenol details
4-[5-(3-hydroxypropyl)-1-benzofuran-2-yl]benzene-1,2-diol → 4-[5-(3-hydroxypropyl)-1-benzofuran-2-yl]-2-methoxyphenol details
3-[2-(3,4-dihydroxyphenyl)-1-benzofuran-5-yl]propanal → 3-[2-(4-hydroxy-3-methoxyphenyl)-1-benzofuran-5-yl]propanal details
2-(3,4-dihydroxy-5-methoxyphenyl)-3,5,7-trihydroxy-1λ⁴-chromen-1-ylium → 3,5,7-trihydroxy-2-(3-hydroxy-4,5-dimethoxyphenyl)-1λ⁴-chromen-1-ylium details
2-(3,4-dihydroxy-5-methoxyphenyl)acetic acid → 2-(3-hydroxy-4,5-dimethoxyphenyl)acetic acid details
3-O-Methylgallic acid → 3,4-O-Dimethylgallic acid details
3-methoxybenzene-1,2-diol → 2,3-dimethoxyphenol details
5-(5-hydroxy-6-methoxy-1-benzofuran-2-yl)-3-methoxybenzene-1,2-diol → 2-(3-hydroxy-4,5-dimethoxyphenyl)-6-methoxy-1-benzofuran-5-ol details
3-(5-hydroxy-6-methoxy-1-benzofuran-2-yl)-5-methoxybenzene-1,2-diol → 2-(3-hydroxy-2,5-dimethoxyphenyl)-6-methoxy-1-benzofuran-5-ol details
3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one details
3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one details
3-(2,4,5-trihydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propane-1,2-dione → 3-(2,4-dihydroxy-5-methoxyphenyl)-1-(2,4,6-trihydroxyphenyl)propane-1,2-dione details
2-oxo-3-(2,4,5-trihydroxyphenyl)propanoic acid → 3-(2,4-dihydroxy-5-methoxyphenyl)-2-oxopropanoic acid details
2-(3,4-Dihydroxyphenyl)-5,6-dihydroxy-7-methoxy-4H-1-benzopyran-4-one → 5,6-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-4H-chromen-4-one details
5,6-dihydroxy-7-methoxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-5,6-dihydroxy-7-methoxy-4H-chromen-4-one details
(2E)-3-(3,4-dihydroxyphenyl)-1-(2,3,4,6-tetrahydroxyphenyl)prop-2-en-1-one → (2E)-3-(4-hydroxy-3-methoxyphenyl)-1-(2,3,4,6-tetrahydroxyphenyl)prop-2-en-1-one details
5,6,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-5,6,7-trihydroxy-4H-chromen-4-one details
5,6,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-5,6,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one details
(2E)-1-(2,3,4,6-tetrahydroxyphenyl)-3-(2,4,5-trihydroxyphenyl)prop-2-en-1-one → (2E)-3-(2,5-dihydroxy-4-methoxyphenyl)-1-(2,3,4,6-tetrahydroxyphenyl)prop-2-en-1-one details
Petunin → 7-hydroxy-2-(3-hydroxy-4,5-dimethoxyphenyl)-3,5-bis({[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy})-1λ⁴-chromen-1-ylium details
Petunidin 3-galactoside → 5,7-dihydroxy-2-(3-hydroxy-4,5-dimethoxyphenyl)-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-1λ⁴-chromen-1-ylium details
2-(3,4-dihydroxy-5-methoxyphenyl)-3,7-dihydroxy-5-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-1λ⁴-chromen-1-ylium → 3,7-dihydroxy-2-(3-hydroxy-4,5-dimethoxyphenyl)-5-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-1λ⁴-chromen-1-ylium details
8-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2,3-dihydroxyphenyl]-5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one → 8-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2-hydroxy-3-methoxyphenyl]-5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one details
8-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2-hydroxyphenyl]-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one → 8-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2-hydroxyphenyl]-5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one details
8-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2,3-dihydroxyphenyl]-5,7-dihydroxy-2-phenyl-4H-chromen-4-one → 8-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2-hydroxy-3-methoxyphenyl]-5,7-dihydroxy-2-phenyl-4H-chromen-4-one details
8-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2-methoxyphenyl]-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one → 8-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2-methoxyphenyl]-5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one details
5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4H-chromen-4-one details
5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one details
1-[2,4,6-trihydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-3-(2,4,5-trihydroxyphenyl)prop-2-en-1-one → 3-(2,4-dihydroxy-5-methoxyphenyl)-1-[2,4,6-trihydroxy-3-(3-methylbut-2-en-1-yl)phenyl]prop-2-en-1-one details
1-[2,4,6-trihydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-3-(2,4,5-trihydroxyphenyl)propan-1-one → 3-(2,4-dihydroxy-5-methoxyphenyl)-1-[2,4,6-trihydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one details
Aspalathin → 3-(4-hydroxy-3-methoxyphenyl)-1-{2,4,6-trihydroxy-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]phenyl}propan-1-one details
Avicularin → 3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → 3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one details
Quercetin → Isorhamnetin details
2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → Dihydroisorhamnetin details
3-(3,4-dihydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propane-1,2-dione → 3-(4-hydroxy-3-methoxyphenyl)-1-(2,4,6-trihydroxyphenyl)propane-1,2-dione details
3-(3,4-dihydroxyphenyl)-2-oxopropanoic acid → Vanilpyruvic acid details
1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-3-[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxypropan-1-one → 1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxy-3-[4-hydroxy-3-methoxy-5-(3-methylbut-2-en-1-yl)phenyl]propan-1-one details
5-(3-methylbut-2-en-1-yl)benzene-1,2,4-triol → 4-methoxy-6-(3-methylbut-2-en-1-yl)benzene-1,3-diol details
3-[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxypropanoic acid → 2-hydroxy-3-[4-hydroxy-3-methoxy-5-(3-methylbut-2-en-1-yl)phenyl]propanoic acid details
2-(3,4-dihydroxyphenyl)-7-hydroxy-4H-chromen-4-one → 7-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one details
2-(2,3-dihydroxy-4-methoxyphenyl)-7-hydroxy-4H-chromen-4-one → 7-hydroxy-2-(3-hydroxy-2,4-dimethoxyphenyl)-4H-chromen-4-one details
2-(3,4-dihydroxyphenyl)-6,7-dihydroxy-4H-chromen-4-one → 6,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one details
7-hydroxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-7-hydroxy-4H-chromen-4-one details
Luteolin → Chrysoeriol details
2-[(3,4-dihydroxyphenyl)methyl]-2,4,6-trihydroxy-2,3-dihydro-1-benzofuran-3-one → 2,4,6-trihydroxy-2-[(4-hydroxy-3-methoxyphenyl)methyl]-2,3-dihydro-1-benzofuran-3-one details
[3-(3,4-dihydroxyphenyl)-1-hydroxyprop-2-en-1-ylidene][(6-{[2-(3,4-dihydroxyphenyl)-7-hydroxy-5-oxo-5H-chromen-3-yl]oxy}-3,4,5-trihydroxyoxan-2-yl)methyl]oxidanium → [3-(3,4-dihydroxyphenyl)-1-hydroxyprop-2-en-1-ylidene][(3,4,5-trihydroxy-6-{[7-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-5-oxo-5H-chromen-3-yl]oxy}oxan-2-yl)methyl]oxidanium details
[3-(3,4-dihydroxyphenyl)-1-hydroxyprop-2-en-1-ylidene][(6-{[2-(3,4-dihydroxyphenyl)-7-hydroxy-5-oxo-5H-chromen-3-yl]oxy}-3,4,5-trihydroxyoxan-2-yl)methyl]oxidanium → [(6-{[2-(3,4-dihydroxyphenyl)-7-hydroxy-5-oxo-5H-chromen-3-yl]oxy}-3,4,5-trihydroxyoxan-2-yl)methyl][1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]oxidanium details
(3,4,5,6-tetrahydroxyoxan-2-yl)methyl (2E)-3-(3,4-dihydroxyphenyl)prop-2-enoate → (3,4,5,6-tetrahydroxyoxan-2-yl)methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enoate details
2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-5-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-1λ⁴-chromen-1-ylium → 3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-5-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-1λ⁴-chromen-1-ylium details
2-(3,4-dihydroxyphenyl)-3,5-dihydroxy-7-methoxy-4H-chromen-4-one → 3,5-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-4H-chromen-4-one details
3-(2,3-dihydroxy-4-methoxyphenyl)-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → 5,7-dihydroxy-3-(2-hydroxy-3,4-dimethoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one details
2-(2,3-dihydroxy-4-methoxyphenyl)-1-(2,4,6-trihydroxyphenyl)propan-1-one → 2-(2-hydroxy-3,4-dimethoxyphenyl)-1-(2,4,6-trihydroxyphenyl)propan-1-one details
2-(2,3-dihydroxy-4-methoxyphenyl)propanoic acid → 2-(2-hydroxy-3,4-dimethoxyphenyl)propanoic acid details
3-(2,3-dihydroxyphenyl)prop-2-enal → 3-(2-hydroxy-3-methoxyphenyl)prop-2-enal details
3-(2,3-dihydroxyphenyl)propanal → 3-(2-hydroxy-3-methoxyphenyl)propanal details
3-(3-hydroxyprop-1-en-1-yl)benzene-1,2-diol → 2-(3-hydroxyprop-1-en-1-yl)-6-methoxyphenol details
(E)-3-(2,3-Dihydroxyphenyl)-2-propenoic acid → 3-(2-hydroxy-3-methoxyphenyl)prop-2-enoic acid details
3-(2,3-dihydroxyphenyl)propanoic acid → 3-(2-hydroxy-3-methoxyphenyl)propanoic acid details
2-Pyrocatechuic acid → 3-Methoxysalicylic acid details
6-[(E)-2-(3-hydroxy-4-methoxyphenyl)ethenyl]benzene-1,2,4-triol → 5-[(E)-2-(3-hydroxy-4-methoxyphenyl)ethenyl]-4-methoxybenzene-1,3-diol details
3-[(E)-2-(3,5-dihydroxyphenyl)ethenyl]-6-methoxybenzene-1,2-diol → 5-[(E)-2-(3-hydroxy-2,4-dimethoxyphenyl)ethenyl]benzene-1,3-diol details
Glyurallin B → 5,7-dihydroxy-3-[3-hydroxy-4-methoxy-5-(3-methylbut-2-en-1-yl)phenyl]-8-(3-methylbut-2-en-1-yl)-4H-chromen-4-one details
3-[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-5,7-dihydroxy-8-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one → 5,7-dihydroxy-3-[3-hydroxy-4-methoxy-5-(3-methylbut-2-en-1-yl)phenyl]-8-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one details
2-[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-1-[2,4,6-trihydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one → 2-[3-hydroxy-4-methoxy-5-(3-methylbut-2-en-1-yl)phenyl]-1-[2,4,6-trihydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one details
2-[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]propanoic acid → 2-[3-hydroxy-4-methoxy-5-(3-methylbut-2-en-1-yl)phenyl]propanoic acid details
7-(3,4-dihydroxy-5-methoxyphenyl)-6,11-dihydroxy-3-(4-hydroxyphenyl)-2λ⁴,8-dioxatricyclo[7.3.1.0⁵,¹³]trideca-1(13),2,4,6,9,11-hexaen-2-ylium → 6,11-dihydroxy-7-(3-hydroxy-4,5-dimethoxyphenyl)-3-(4-hydroxyphenyl)-2λ⁴,8-dioxatricyclo[7.3.1.0⁵,¹³]trideca-1(13),2,4,6,9,11-hexaen-2-ylium details
Pinotin A aglycone → 6,11-dihydroxy-7-(4-hydroxy-3,5-dimethoxyphenyl)-3-(4-hydroxy-3-methoxyphenyl)-2λ⁴,8-dioxatricyclo[7.3.1.0⁵,¹³]trideca-1(13),2,4,6,9,11-hexaen-2-ylium details
Epifisetinidol-(4beta->8)-epicatechin-(6->4beta)-epifisetinidol → 6,8-bis[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
Epifisetinidol-(4beta->8)-epicatechin-(6->4beta)-epifisetinidol → 8-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
Epifisetinidol-(4beta->8)-epicatechin-(6->4beta)-epifisetinidol → 6-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
6,8-bis[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
6,8-bis[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 6-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-6-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-8-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-6-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-8-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
6,8-bis[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 6,8-bis[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
Epifisetinidol-(4beta->8)-catechin → 8-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
Epifisetinidol-(4beta->8)-catechin → 8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(3,4-dihydroxyphenyl)-8-[1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)-2-hydroxypropyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(3,4-dihydroxyphenyl)-8-[1-(2,4-dihydroxyphenyl)-2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(3,4-dihydroxyphenyl)-8-[1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)-2-hydroxypropyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)-2-hydroxypropyl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → Arachidoside details
3,3',4',7-Tetrahydroxyflavan → 2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,7-diol details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[3,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(3,4-dihydroxyphenyl)-8-[1-(2,4-dihydroxyphenyl)-2-hydroxy-3-(3-hydroxyphenyl)propyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[1-(2,4-dihydroxyphenyl)-2-hydroxy-3-(3-hydroxyphenyl)propyl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
8-[1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)-2-hydroxypropyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[1-(2,4-dihydroxyphenyl)-2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
5-(3',4'-Dihydroxyphenyl)-gamma-valerolactone → 5'-(3'-Methoxy-4'-hydroxyphenyl)-gamma-valerolactone details
2-[3-(3,4-dihydroxyphenyl)-2-hydroxypropyl]benzene-1,3,5-triol → 2-[2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propyl]benzene-1,3,5-triol details
4-Hydroxy-(3',4'-dihydroxyphenyl)-valeric acid → 4-hydroxy-5-(4-hydroxy-3-methoxyphenyl)pentanoic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-4-one → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-4-one details
2-(3,4-dihydroxyphenyl)-3,5-dihydroxy-7-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-4-one → Isorhamnetin 7-glucoside details
phenyl 2,3-dihydroxybenzoate → phenyl 2-hydroxy-3-methoxybenzoate details
3-methoxy-5-(prop-2-en-1-yl)benzene-1,2-diol → Methoxyeugenol details
(E)-3-(2,3-Dihydroxyphenyl)-2-propenoic acid → 3-(2-Hydroxy-3-methoxyphenyl)-2-propenoic acid details
3-phenyl-1-(2,4,5-trihydroxyphenyl)propan-1-one → 1-(2,5-dihydroxy-4-methoxyphenyl)-3-phenylpropan-1-one details
3-phenyl-1-(2,3,5-trihydroxyphenyl)propan-1-one → 1-(2,5-dihydroxy-3-methoxyphenyl)-3-phenylpropan-1-one details
3-phenyl-1-(2,3,6-trihydroxyphenyl)propan-1-one → 1-(3,6-dihydroxy-2-methoxyphenyl)-3-phenylpropan-1-one details
1-(3,4-dihydroxyphenyl)-3-phenylpropan-1-one → 1-(4-hydroxy-3-methoxyphenyl)-3-phenylpropan-1-one details
1-(3,4-dihydroxyphenyl)-3-(2-hydroxyphenyl)propan-1-one → 1-(4-hydroxy-3-methoxyphenyl)-3-(2-hydroxyphenyl)propan-1-one details
3-phenyl-1-(2,4,5-trihydroxyphenyl)propan-1-one → 1-(2,4-dihydroxy-5-methoxyphenyl)-3-phenylpropan-1-one details
1-(3,4-dihydroxyphenyl)-3-hydroxy-3-phenylpropan-1-one → 3-hydroxy-1-(4-hydroxy-3-methoxyphenyl)-3-phenylpropan-1-one details
1-(3,4-dihydroxyphenyl)-3-(3-hydroxyphenyl)propan-1-one → 1-(4-hydroxy-3-methoxyphenyl)-3-(3-hydroxyphenyl)propan-1-one details
1-(3,4-dihydroxyphenyl)-3-(4-hydroxyphenyl)propan-1-one → 1-(4-hydroxy-3-methoxyphenyl)-3-(4-hydroxyphenyl)propan-1-one details
4-(3,4-dihydroxy-5-methoxyphenyl)but-3-en-2-one → 4-(4-hydroxy-3,5-dimethoxyphenyl)but-3-en-2-one details
4-(3,4-dihydroxy-5-methoxyphenyl)butan-2-one → 4-(4-hydroxy-3,5-dimethoxyphenyl)butan-2-one details
3-(2,3-dihydroxy-4-methoxyphenyl)-8,8-dimethyl-2H,8H-pyrano[2,3-f]chromen-2-one → 3-(2-hydroxy-3,4-dimethoxyphenyl)-8,8-dimethyl-2H,8H-pyrano[2,3-f]chromen-2-one details
5-[2-(2-hydroxyphenyl)ethyl]-3-methoxybenzene-1,2-diol → 5-[2-(2-hydroxyphenyl)ethyl]-2,3-dimethoxyphenol details
3-[2-(2-hydroxyphenyl)ethyl]-5-methoxybenzene-1,2-diol → 3-[2-(2-hydroxyphenyl)ethyl]-2,5-dimethoxyphenol details
3-[2-(3-hydroxy-5-methoxyphenyl)ethyl]benzene-1,2-diol → 2-[2-(3-hydroxy-5-methoxyphenyl)ethyl]-6-methoxyphenol details
7-hydroxy-5-methoxy-3-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 3-(2,4-dihydroxy-5-methoxyphenyl)-7-hydroxy-5-methoxy-4H-chromen-4-one details
2-(2,4-dihydroxyphenyl)-1-(3,4,6-trihydroxy-2-methoxyphenyl)propan-1-one → 1-(4,6-dihydroxy-2,3-dimethoxyphenyl)-2-(2,4-dihydroxyphenyl)propan-1-one details
7-hydroxy-5-methoxy-3-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → 3-(2,4-dihydroxy-5-methoxyphenyl)-7-hydroxy-5-methoxy-3,4-dihydro-2H-1-benzopyran-4-one details
5-(4,7-dihydroxy-5-methoxy-3,4-dihydro-2H-1-benzopyran-3-yl)benzene-1,2,4-triol → 3-(2,4-dihydroxy-5-methoxyphenyl)-5-methoxy-3,4-dihydro-2H-1-benzopyran-4,7-diol details
1-(2,4-dihydroxy-6-methoxyphenyl)-2-(2,4,5-trihydroxyphenyl)propan-1-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-1-(2,4-dihydroxy-6-methoxyphenyl)propan-1-one details
5-(7-hydroxy-5-methoxy-3,4-dihydro-2H-1-benzopyran-3-yl)benzene-1,2,4-triol → 4-(7-hydroxy-5-methoxy-3,4-dihydro-2H-1-benzopyran-3-yl)-6-methoxybenzene-1,3-diol details
5-hydroxy-7-methoxy-3-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 3-(2,4-dihydroxy-5-methoxyphenyl)-5-hydroxy-7-methoxy-4H-chromen-4-one details
5-hydroxy-7-methoxy-3-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → 3-(2,4-dihydroxy-5-methoxyphenyl)-5-hydroxy-7-methoxy-3,4-dihydro-2H-1-benzopyran-4-one details
13-(3,4-dihydroxyphenyl)-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → 13-(4-hydroxy-3-methoxyphenyl)-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol details
Prunus inhibitor b → 5-(4-hydroxy-3-methoxyphenyl)-13-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol details
13-(3,4-dihydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → 13-(4-hydroxy-3-methoxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol details
5-(3,4-dihydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → 5-(4-hydroxy-3-methoxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol details
(2E)-N-[2-(3,4-dihydroxyphenyl)-2-hydroxyethyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid → (2E)-N-[2-hydroxy-2-(4-hydroxy-3-methoxyphenyl)ethyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid details
(2E)-3-(3,4-dihydroxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid → N-trans-Feruloyloctopamine details
N-[2-(3,4-dihydroxyphenyl)-2-hydroxyethyl]-3-(4-hydroxyphenyl)propanimidic acid → N-[2-hydroxy-2-(4-hydroxy-3-methoxyphenyl)ethyl]-3-(4-hydroxyphenyl)propanimidic acid details
3-(3,4-dihydroxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]propanimidic acid → N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
3-(3,4-dihydroxy-5-methoxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid → N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enimidic acid details
N-[2-(3,4-dihydroxyphenyl)-2-hydroxyethyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid → N-[2-hydroxy-2-(4-hydroxy-3-methoxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid details
3-(3,4-dihydroxy-5-methoxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]propanimidic acid → N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3,5-dimethoxyphenyl)propanimidic acid details
N-[2-(3,4-dihydroxyphenyl)-2-hydroxyethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-[2-hydroxy-2-(4-hydroxy-3-methoxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
4-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]benzene-1,2-diol → 4-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]-2-methoxyphenol details
5-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]-3-methoxybenzene-1,2-diol → 4-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]-2,6-dimethoxyphenol details
Epicatechin-(6'->8)-epicatechin → 8-[4,5-dihydroxy-2-(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)phenyl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
8-[4,5-dihydroxy-2-(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)phenyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[4-hydroxy-5-methoxy-2-(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)phenyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
Meloside L → Isoscoparin 2''-O-glucoside details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one → 6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-5,7-dihydroxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-5,7-dihydroxy-4H-chromen-4-one details
3-(7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl)-6-methoxybenzene-1,2-diol → Isomucronulatol details
Hovenitin I → 3,5,7-trihydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one details
3-(3,4-dihydroxy-5-methoxyphenyl)-1-(2,4,6-trihydroxyphenyl)propane-1,2-dione → 3-(4-hydroxy-3,5-dimethoxyphenyl)-1-(2,4,6-trihydroxyphenyl)propane-1,2-dione details
6-[(E)-2-(2,3-dihydroxy-4-methoxyphenyl)ethenyl]-4-methoxy-2H-pyran-2-one → 6-[(E)-2-(3-hydroxy-2,4-dimethoxyphenyl)ethenyl]-4-methoxy-2H-pyran-2-one details
3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]propanimidic acid → N-Dihydroferuloyltyramine details
3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]oxirane-2-carboximidic acid → 3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]oxirane-2-carboximidic acid details
(2E)-N-[2-(4-hydroxyphenyl)ethyl]-3-(2,4,5-trihydroxyphenyl)prop-2-enimidic acid → (2E)-3-(2,4-dihydroxy-5-methoxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid details
(2E)-3-(3,4-dihydroxyphenyl)-N-[2-(3,4-dihydroxyphenyl)ethyl]prop-2-enimidic acid → (2E)-N-[2-(3,4-dihydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid details
(2E)-3-(3,4-dihydroxyphenyl)-N-[2-(3,4-dihydroxyphenyl)ethyl]prop-2-enimidic acid → (2E)-3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxy-3-methoxyphenyl)ethyl]prop-2-enimidic acid details
(2E)-3-(3,4-dihydroxyphenyl)-N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]prop-2-enimidic acid → (2E)-3-(4-hydroxy-3-methoxyphenyl)-N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]prop-2-enimidic acid details
(2Z)-3-(3,4-dihydroxyphenyl)-2-hydroxy-N-[2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid → (2Z)-2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid details
3-(3,4-dihydroxyphenyl)-3-hydroxy-N-[2-(4-hydroxyphenyl)ethyl]propanimidic acid → 3-hydroxy-3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]propanimidic acid details
N-[2-(4-hydroxyphenyl)ethyl]-3-(2,4,5-trihydroxyphenyl)propanimidic acid → 3-(2,4-dihydroxy-5-methoxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]propanimidic acid details
3-(3,4-dihydroxyphenyl)-N-[2-(3,4-dihydroxyphenyl)ethyl]propanimidic acid → N-[2-(3,4-dihydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
3-(3,4-dihydroxyphenyl)-N-[2-(3,4-dihydroxyphenyl)ethyl]propanimidic acid → 3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxy-3-methoxyphenyl)ethyl]propanimidic acid details
3-(3,4-dihydroxyphenyl)-2-hydroxy-N-[2-(4-hydroxyphenyl)ethyl]propanimidic acid → 2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]propanimidic acid details
3-(3,4-dihydroxyphenyl)-N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]propanimidic acid → 3-(4-hydroxy-3-methoxyphenyl)-N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]propanimidic acid details
Theaflavate B → 6,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl 3,4,6-trihydroxy-5-oxo-1-(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)-5H-benzo[7]annulene-8-carboxylate details
2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,6,7-triol → 2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,6,7-triol details
Theaflavate A → 6,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl 1-[5,7-dihydroxy-3-(3,4,5-trihydroxybenzoyloxy)-3,4-dihydro-2H-1-benzopyran-2-yl]-3,4,6-trihydroxy-5-oxo-5H-benzo[7]annulene-8-carboxylate details
4-[(E)-2-hydroxyethenyl]benzene-1,2-diol → 4-[(E)-2-hydroxyethenyl]-2-methoxyphenol details
5-[(E)-2-hydroxyethenyl]benzene-1,2,4-triol → 4-[(E)-2-hydroxyethenyl]-6-methoxybenzene-1,3-diol details
2-[(3,4-dihydroxyphenyl)methylidene]-6-hydroxy-2,3-dihydro-1-benzofuran-3-one → 6-hydroxy-2-[(4-hydroxy-3-methoxyphenyl)methylidene]-2,3-dihydro-1-benzofuran-3-one details
2-[(3,4-dihydroxyphenyl)methyl]-6-hydroxy-2,3-dihydro-1-benzofuran-3-one → 6-hydroxy-2-[(4-hydroxy-3-methoxyphenyl)methyl]-2,3-dihydro-1-benzofuran-3-one details
4,5-dihydroxy-2-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}benzoic acid → 4-hydroxy-2-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}-5-methoxybenzoic acid details
2-{[3-(3,4-dihydroxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxybenzoic acid → 5-hydroxy-2-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid details
2,3-dihydroxy-6-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid → 3-hydroxy-6-{[1-hydroxy-3-(4-hydroxy-3-methoxyphenyl)prop-2-en-1-ylidene]amino}-2,4-dimethoxybenzoic acid details
2-{[3-(3,4-dihydroxy-5-methoxyphenyl)-1-hydroxyprop-2-en-1-ylidene]amino}-5-hydroxy-4-methoxybenzoic acid → 5-hydroxy-2-{[1-hydroxy-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid details
4,5-dihydroxy-2-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}benzoic acid → 4-hydroxy-2-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}-5-methoxybenzoic acid details
2,3-dihydroxy-6-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}-4-methoxybenzoic acid → 3-hydroxy-6-{[1-hydroxy-3-(3-methoxyphenyl)prop-2-en-1-ylidene]amino}-2,4-dimethoxybenzoic acid details
5,7,8-trihydroxy-3-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 3-(2,4-dihydroxy-5-methoxyphenyl)-5,7,8-trihydroxy-4H-chromen-4-one details
5,7,8-trihydroxy-3-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → 3-(2,4-dihydroxy-5-methoxyphenyl)-5,7,8-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one details
1-(2,3,4,6-tetrahydroxyphenyl)-2-(2,4,5-trihydroxyphenyl)propan-1-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-1-(2,3,4,6-tetrahydroxyphenyl)propan-1-one details
2-(2,4,5-trihydroxyphenyl)propanoic acid → 2-(2,4-dihydroxy-5-methoxyphenyl)propanoic acid details
7-(3,4-dihydroxyphenyl)-5-methoxy-1-phenylheptan-3-one → 7-(4-Hydroxy-3-methoxyphenyl)-5-methoxy-1-phenyl-3-heptanone details
(4E)-7-(3,4-dihydroxyphenyl)-1-phenylhept-4-en-3-one → (4E)-7-(4-hydroxy-3-methoxyphenyl)-1-phenylhept-4-en-3-one details
7-(3,4-dihydroxyphenyl)-1-phenylheptan-3-one → 7-(4-hydroxy-3-methoxyphenyl)-1-phenylheptan-3-one details
3-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl]-6-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,2,4-triol → 2-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl]-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-4-methoxybenzene-1,3-diol details
5-[(E)-2-{4-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl]-3,5-dihydroxyphenyl}ethenyl]benzene-1,2,4-triol → 5-[(E)-2-(2,4-dihydroxy-5-methoxyphenyl)ethenyl]-2-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl]benzene-1,3-diol details
5-[6-(2,4-dihydroxyphenyl)-2-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-4-methylcyclohex-3-ene-1-carbonyl]benzene-1,2,4-triol → 2-[6-(2,4-dihydroxy-5-methoxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl]-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol details
5-[6-(2,4-dihydroxybenzoyl)-5-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-3-methylcyclohex-3-en-1-yl]benzene-1,2,4-triol → 2-[5-(2,4-dihydroxy-5-methoxyphenyl)-6-(2,4-dihydroxybenzoyl)-3-methylcyclohex-2-en-1-yl]-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol details
8-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-10,18-dihydroxy-14-methyl-4-(2,4,5-trihydroxyphenyl)-3,5,15-trioxahexacyclo[12.7.1.0²,⁴.0²,¹².0⁶,¹¹.0¹⁶,²¹]docosa-6,8,10,16(21),17,19-hexaen-13-one → 4-(2,4-dihydroxy-5-methoxyphenyl)-8-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-10,18-dihydroxy-14-methyl-3,5,15-trioxahexacyclo[12.7.1.0²,⁴.0²,¹².0⁶,¹¹.0¹⁶,²¹]docosa-6,8,10,16(21),17,19-hexaen-13-one details
4-(2,4-dihydroxyphenyl)-10,18-dihydroxy-14-methyl-8-[(E)-2-(2,4,5-trihydroxyphenyl)ethenyl]-3,5,15-trioxahexacyclo[12.7.1.0²,⁴.0²,¹².0⁶,¹¹.0¹⁶,²¹]docosa-6,8,10,16(21),17,19-hexaen-13-one → 8-[(E)-2-(2,4-dihydroxy-5-methoxyphenyl)ethenyl]-4-(2,4-dihydroxyphenyl)-10,18-dihydroxy-14-methyl-3,5,15-trioxahexacyclo[12.7.1.0²,⁴.0²,¹².0⁶,¹¹.0¹⁶,²¹]docosa-6,8,10,16(21),17,19-hexaen-13-one details
3-(3,4-Dihydroxybenzyl)-7-hydroxy-5-methoxy-4-chromanone → 7-hydroxy-3-[(4-hydroxy-3-methoxyphenyl)methyl]-5-methoxy-3,4-dihydro-2H-1-benzopyran-4-one details
3-[(2,3-dihydroxy-4-methoxyphenyl)methyl]-7-hydroxy-5-methoxy-3,4-dihydro-2H-1-benzopyran-4-one → 7-hydroxy-3-[(3-hydroxy-2,4-dimethoxyphenyl)methyl]-5-methoxy-3,4-dihydro-2H-1-benzopyran-4-one details
6-(6-hydroxy-1-benzofuran-2-yl)benzene-1,2,4-triol → 5-(6-hydroxy-1-benzofuran-2-yl)-4-methoxybenzene-1,3-diol details
6-(5-hydroxy-6-methoxy-1-benzofuran-2-yl)benzene-1,2,4-triol → 5-(5-hydroxy-6-methoxy-1-benzofuran-2-yl)-4-methoxybenzene-1,3-diol details
6-(5,6-dimethoxy-1-benzofuran-2-yl)benzene-1,2,4-triol → 5-(5,6-dimethoxy-1-benzofuran-2-yl)-4-methoxybenzene-1,3-diol details
6-(6-hydroxy-1-benzofuran-2-yl)-3-(3-methylbut-2-en-1-yl)benzene-1,2,4-triol → 5-(6-hydroxy-1-benzofuran-2-yl)-4-methoxy-2-(3-methylbut-2-en-1-yl)benzene-1,3-diol details
3-(6-hydroxy-1-benzofuran-2-yl)-5-methoxy-4-(3-methylbut-2-en-1-yl)benzene-1,2-diol → 2-[3-hydroxy-2,5-dimethoxy-6-(3-methylbut-2-en-1-yl)phenyl]-1-benzofuran-6-ol details
5-(6-hydroxy-1-benzofuran-2-yl)-3-methoxy-4-(3-methylbut-2-en-1-yl)benzene-1,2-diol → 2-[5-hydroxy-3,4-dimethoxy-2-(3-methylbut-2-en-1-yl)phenyl]-1-benzofuran-6-ol details
6-{12-methyl-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7,12-pentaen-4-yl}benzene-1,2,4-triol → 4-methoxy-5-{12-methyl-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7,12-pentaen-4-yl}benzene-1,3-diol details
6-{7-methoxy-12-methyl-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7,12-pentaen-4-yl}benzene-1,2,4-triol → 4-methoxy-5-{7-methoxy-12-methyl-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7,12-pentaen-4-yl}benzene-1,3-diol details
2-[2-(3,4-dihydroxyphenyl)-7-hydroxy-3-(hydroxymethyl)-2,3-dihydro-1-benzofuran-5-yl]-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → Silyhermin details
2-[2-(3,4-dihydroxy-5-methoxyphenyl)-7-hydroxy-3-(hydroxymethyl)-2,3-dihydro-1-benzofuran-5-yl]-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → 5,7-dihydroxy-2-[7-hydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)-3-(hydroxymethyl)-2,3-dihydro-1-benzofuran-5-yl]-3,4-dihydro-2H-1-benzopyran-4-one details
6-[(E)-2-{4-hydroxy-3-[(1E)-3-methylbuta-1,3-dien-1-yl]phenyl}ethenyl]benzene-1,2,4-triol → 5-[(E)-2-{4-hydroxy-3-[(1E)-3-methylbuta-1,3-dien-1-yl]phenyl}ethenyl]-4-methoxybenzene-1,3-diol details
5-[(E)-2-(3,5-dihydroxyphenyl)ethenyl]-3-[(1E)-3-methylbuta-1,3-dien-1-yl]benzene-1,2-diol → 5-[(E)-2-{4-hydroxy-3-methoxy-5-[(1E)-3-methylbuta-1,3-dien-1-yl]phenyl}ethenyl]benzene-1,3-diol details
4-{5-hydroxy-2-oxa-6,11-diazatetracyclo[7.5.2.0⁴,¹⁵.0¹²,¹⁶]hexadeca-1(15),5,9,12(16),13-pentaen-3-yl}benzene-1,2-diol → Moschamindole details
5-{5-hydroxy-2-oxa-6,11-diazatetracyclo[7.5.2.0⁴,¹⁵.0¹²,¹⁶]hexadeca-1(15),5,9,12(16),13-pentaen-3-yl}-3-methoxybenzene-1,2-diol → 3-(4-hydroxy-3,5-dimethoxyphenyl)-2-oxa-6,11-diazatetracyclo[7.5.2.0⁴,¹⁵.0¹²,¹⁶]hexadeca-1(15),5,9,12(16),13-pentaen-5-ol details
8-(2-aminoethyl)-2-(3,4-dihydroxy-5-methoxyphenyl)-1H,2H,6H-furo[3,2-e]indole-1-carboxylic acid → 8-(2-aminoethyl)-2-(4-hydroxy-3,5-dimethoxyphenyl)-1H,2H,6H-furo[3,2-e]indole-1-carboxylic acid details
(2E)-N-(4-aminobutyl)-3-(3,4-dihydroxyphenyl)prop-2-enimidic acid → (2E)-N-(4-aminobutyl)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid details
N-(4-aminobutyl)-3-(3,4-dihydroxyphenyl)propanimidic acid → N-(4-aminobutyl)-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
(2E)-N-(4-amino-2-hydroxybutyl)-3-(3,4-dihydroxyphenyl)prop-2-enimidic acid → Feruloyl-2-hydroxyputrescine details
N-(4-amino-2-hydroxybutyl)-3-(3,4-dihydroxyphenyl)propanimidic acid → N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
N-(4-aminobutyl)-3-(3,4-dihydroxyphenyl)prop-2-enimidic acid → N-(4-aminobutyl)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid details
N-(4-aminobutyl)-3-(3,4-dihydroxy-5-methoxyphenyl)prop-2-enimidic acid → N-(4-aminobutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enimidic acid details
N-(4-aminobutyl)-3-(3,4-dihydroxy-5-methoxyphenyl)propanimidic acid → N-(4-aminobutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)propanimidic acid details
N-(4-aminobutyl)-3-(3,4-dihydroxy-5-methoxyphenyl)prop-2-enimidic acid → N-(4-aminobutyl)-3-(3-hydroxy-4,5-dimethoxyphenyl)prop-2-enimidic acid details
N-(4-aminobutyl)-3-(3,4-dihydroxy-5-methoxyphenyl)propanimidic acid → N-(4-aminobutyl)-3-(3-hydroxy-4,5-dimethoxyphenyl)propanimidic acid details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]butyl}-3-(3,4-dihydroxy-5-methoxyphenyl)prop-2-enamide → N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]butyl}-3-(3-hydroxy-4,5-dimethoxyphenyl)prop-2-enamide details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]butyl}-3-(3,4-dihydroxy-5-methoxyphenyl)propanamide → N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]butyl}-3-(3-hydroxy-4,5-dimethoxyphenyl)propanamide details
4-[5-(2-hydroxy-1-methoxypropyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]benzene-1,2-diol → Fragransol A details
5-[5-(2-hydroxy-1-methoxypropyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]-3-methoxybenzene-1,2-diol → 4-[5-(2-hydroxy-1-methoxypropyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]-2,6-dimethoxyphenol details
4-[5-(2-hydroxyethyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]benzene-1,2-diol → Fragransol B details
5-[5-(2-hydroxyethyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]-3-methoxybenzene-1,2-diol → 4-[5-(2-hydroxyethyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]-2,6-dimethoxyphenol details
Neocarlinoside → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one details
7-hydroxy-8-(3-methylbut-2-en-1-yl)-3-[2,4,5-trihydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-2H-chromen-2-one → 3-[2,4-dihydroxy-5-methoxy-3-(3-methylbut-2-en-1-yl)phenyl]-7-hydroxy-8-(3-methylbut-2-en-1-yl)-2H-chromen-2-one details
2-(4,5-dihydroxy-2-{[6-hydroxy-7-(3-methylbut-2-en-1-yl)-3-oxo-2,3-dihydro-1-benzofuran-2-yl]methyl}phenyl)-6-hydroxy-2-[4-hydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(3-methylbut-2-en-1-yl)-2,3-dihydro-1-benzofuran-3-one → 6-hydroxy-2-(4-hydroxy-2-{[6-hydroxy-7-(3-methylbut-2-en-1-yl)-3-oxo-2,3-dihydro-1-benzofuran-2-yl]methyl}-5-methoxyphenyl)-2-[4-hydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(3-methylbut-2-en-1-yl)-2,3-dihydro-1-benzofuran-3-one details
2-(4,5-dihydroxy-2-{[6-hydroxy-7-(3-methylbut-2-en-1-yl)-3-oxo-2,3-dihydro-1-benzofuran-2-ylidene]methyl}phenyl)-6-hydroxy-5-(3-methylbut-2-en-1-yl)-2,3-dihydro-1-benzofuran-3-one → 6-hydroxy-2-(4-hydroxy-2-{[6-hydroxy-7-(3-methylbut-2-en-1-yl)-3-oxo-2,3-dihydro-1-benzofuran-2-ylidene]methyl}-5-methoxyphenyl)-5-(3-methylbut-2-en-1-yl)-2,3-dihydro-1-benzofuran-3-one details
3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)benzoic acid → 4-hydroxy-3-methoxy-5-(3-methylbut-2-en-1-yl)benzoic acid details
2-(4,5-dihydroxy-2-{[6-hydroxy-7-(3-methylbut-2-en-1-yl)-3-oxo-2,3-dihydro-1-benzofuran-2-yl]methyl}phenyl)-6-hydroxy-5-(3-methylbut-2-en-1-yl)-2,3-dihydro-1-benzofuran-3-one → 6-hydroxy-2-(4-hydroxy-2-{[6-hydroxy-7-(3-methylbut-2-en-1-yl)-3-oxo-2,3-dihydro-1-benzofuran-2-yl]methyl}-5-methoxyphenyl)-5-(3-methylbut-2-en-1-yl)-2,3-dihydro-1-benzofuran-3-one details
3'-Hydroxygenistein → 5,7-dihydroxy-3-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one details
3',4',5,7-Tetrahydroxyisoflavanone → 5,7-dihydroxy-3-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one details
2-(3,4-dihydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propan-1-one → 2-(4-hydroxy-3-methoxyphenyl)-1-(2,4,6-trihydroxyphenyl)propan-1-one details
4-(3,7-dimethylocta-2,6-dien-1-yl)-3-(6-hydroxy-1-benzofuran-2-yl)-5-methoxybenzene-1,2-diol → 2-[2-(3,7-dimethylocta-2,6-dien-1-yl)-5-hydroxy-3,6-dimethoxyphenyl]-1-benzofuran-6-ol details
4-(3,7-dimethylocta-2,6-dien-1-yl)-5-(6-hydroxy-1-benzofuran-2-yl)-3-methoxybenzene-1,2-diol → 2-[2-(3,7-dimethylocta-2,6-dien-1-yl)-5-hydroxy-3,4-dimethoxyphenyl]-1-benzofuran-6-ol details
KB 2 → 2-(2,5-dihydroxy-4-methoxyphenyl)-5-hydroxy-3-(3-hydroxy-3-methylbutyl)-8,8-dimethyl-4H,8H-pyrano[2,3-f]chromen-4-one details
4-{8,8-dimethyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-3-yl}-3-methoxybenzene-1,2-diol → 4-{8,8-dimethyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-3-yl}-2,3-dimethoxyphenol details
4-{8,8-dimethyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-3-yl}-5-methoxybenzene-1,2-diol → 4-{8,8-dimethyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-3-yl}-2,5-dimethoxyphenol details
3'-Hydroxy-4'-methoxyglabridin → 6-{8,8-dimethyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-3-yl}-2,3-dimethoxyphenol details
3-(2,3-dihydroxyphenyl)propanoic acid → 3-(3-hydroxy-2-methoxyphenyl)propanoic acid details
2-Pyrocatechuic acid → 3-hydroxy-2-methoxybenzoic acid details
3-(2,3-dihydroxy-4-methoxyphenyl)prop-2-enoic acid → 3-(3-hydroxy-2,4-dimethoxyphenyl)prop-2-enoic acid details
3-(2,3-dihydroxy-4-methoxyphenyl)propanoic acid → 3-(3-hydroxy-2,4-dimethoxyphenyl)propanoic acid details
2,3-dihydroxy-4-methoxybenzoic acid → 3-hydroxy-2,4-dimethoxybenzoic acid details
(2E)-3-(2,3-dihydroxyphenyl)prop-2-enoic acid → (2E)-3-(3-hydroxy-2-methoxyphenyl)prop-2-enoic acid details
3,4-Dihydroxyphenylvaleric acid → 5-(4-hydroxy-3-methoxyphenyl)pentanoic acid details
1-chloro-2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-1,5-dihydrochromen-1-ium-5-ide → 1-chloro-3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-1,5-dihydrochromen-1-ium-5-ide details
4-[(1E)-3-hydroxyprop-1-en-1-yl]benzene-1,2-diol → Coniferyl alcohol details
(2E)-3-(3,4-dihydroxyphenyl)prop-2-enal → (2E)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enal details
5-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]benzene-1,2,3-triol → 5-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]benzene-1,2,3-triol details
6-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]benzene-1,2,4-triol → 6-[(E)-2-(4-hydroxy-3-methoxyphenyl)ethenyl]benzene-1,2,4-triol details
4-[3-(3,5-dihydroxyphenyl)oxiran-2-yl]benzene-1,2-diol → 5-[3-(4-hydroxy-3-methoxyphenyl)oxiran-2-yl]benzene-1,3-diol details
2-(3,4-dihydroxyphenyl)-7-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-4-one → 2-(4-hydroxy-3-methoxyphenyl)-7-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-4-one details
Methyldopa → (2S)-2-amino-3-(4-hydroxy-3-methoxyphenyl)-2-methylpropanoic acid details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethylpropanamide → 2-cyano-N,N-diethyl-3-(4-hydroxy-3-methoxy-5-nitrophenyl)propanamide details
2-cyano-N,N-diethyl-3-(2,4,5-trihydroxy-3-nitrophenyl)prop-2-enamide → 2-cyano-3-(2,4-dihydroxy-5-methoxy-3-nitrophenyl)-N,N-diethylprop-2-enamide details
3-(3-amino-4,5-dihydroxyphenyl)-2-cyano-N,N-diethylprop-2-enamide → 3-(3-amino-4-hydroxy-5-methoxyphenyl)-2-cyano-N,N-diethylprop-2-enamide details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethyloxirane-2-carboxamide → 2-cyano-N,N-diethyl-3-(4-hydroxy-3-methoxy-5-nitrophenyl)oxirane-2-carboxamide details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N-ethyl-N-(2-hydroxyethyl)prop-2-enamide → 2-cyano-N-ethyl-3-(4-hydroxy-3-methoxy-5-nitrophenyl)-N-(2-hydroxyethyl)prop-2-enamide details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethyl-3-hydroxypropanamide → 2-cyano-N,N-diethyl-3-hydroxy-3-(4-hydroxy-3-methoxy-5-nitrophenyl)propanamide details
2-cyano-N,N-diethyl-3-(2,4,5-trihydroxy-3-nitrophenyl)propanamide → 2-cyano-3-(2,4-dihydroxy-5-methoxy-3-nitrophenyl)-N,N-diethylpropanamide details
3-(3-amino-4,5-dihydroxyphenyl)-2-cyano-N,N-diethylpropanamide → 3-(3-amino-4-hydroxy-5-methoxyphenyl)-2-cyano-N,N-diethylpropanamide details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N-ethyl-N-(2-hydroxyethyl)propanamide → 2-cyano-N-ethyl-3-(4-hydroxy-3-methoxy-5-nitrophenyl)-N-(2-hydroxyethyl)propanamide details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethyl-2-hydroxypropanamide → 2-cyano-N,N-diethyl-2-hydroxy-3-(4-hydroxy-3-methoxy-5-nitrophenyl)propanamide details
2-(3,4-dihydroxyphenyl)-8-[(1S)-3-(3,4-dihydroxyphenyl)-2-hydroxy-1-(2,4,6-trihydroxyphenyl)propyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[3-(3,4-dihydroxyphenyl)-2-hydroxy-1-(2,4,6-trihydroxyphenyl)propyl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(3,4-dihydroxyphenyl)-8-[(1S)-3-(3,4-dihydroxyphenyl)-2-hydroxy-1-(2,4,6-trihydroxyphenyl)propyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(3,4-dihydroxyphenyl)-8-[2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)-1-(2,4,6-trihydroxyphenyl)propyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
(4S)-2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(4-hydroxy-3-methoxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
(4S)-4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
8-[3-(3,4-dihydroxyphenyl)-2-hydroxy-1-(2,4,6-trihydroxyphenyl)propyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)-1-(2,4,6-trihydroxyphenyl)propyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(3,4-dihydroxyphenyl)-8-[2-hydroxy-3-(3-hydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 8-[2-hydroxy-3-(3-hydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propyl]-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
3-[(1E)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl]benzene-1,2-diol → 3-[(1E)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl]-2-methoxyphenol details
3,4-Dihydroxy-tamoxifen → 4-[(1E)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl]-2-methoxyphenol details
4-[(3Z)-4-(4-hydroxyphenyl)hex-3-en-3-yl]benzene-1,2-diol → 4-[(3Z)-4-(4-hydroxyphenyl)hex-3-en-3-yl]-2-methoxyphenol details
2-(3,4-dihydroxy-5-methoxyphenyl)-3-hydroxy-5-sulfino-3,4-dihydro-2H-1-benzopyran-7-olate → 3-hydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)-5-sulfino-3,4-dihydro-2H-1-benzopyran-7-olate details
2-[2,3-dihydroxy-4-(methoxymethyl)phenyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-[3-hydroxy-2-methoxy-4-(methoxymethyl)phenyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(2,3-dihydroxy-4-methoxyphenyl)-3-hydroxy-5-sulfino-3,4-dihydro-2H-1-benzopyran-7-olate → 3-hydroxy-2-(3-hydroxy-2,4-dimethoxyphenyl)-5-sulfino-3,4-dihydro-2H-1-benzopyran-7-olate details
4-(3,5-dihydroxy-7-sulfino-3,4-dihydro-2H-1-benzopyran-2-yl)-2-hydroxybenzen-1-olate → 4-(3,5-dihydroxy-7-sulfino-3,4-dihydro-2H-1-benzopyran-2-yl)-2-methoxybenzen-1-olate details
2-(2,3-dihydroxy-4-methoxyphenyl)-3-hydroxy-7-sulfino-3,4-dihydro-2H-1-benzopyran-5-olate → 3-hydroxy-2-(3-hydroxy-2,4-dimethoxyphenyl)-7-sulfino-3,4-dihydro-2H-1-benzopyran-5-olate details
2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-5H-chromen-5-yl → 3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-5H-chromen-5-yl details
2-(3,4-dihydroxy-5-methoxyphenyl)-3,5,7-trihydroxy-5H-chromen-5-yl → 3,5,7-trihydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)-5H-chromen-5-yl details
Cinchonain Id 7-glucoside → 12-(3,4-dihydroxyphenyl)-13-hydroxy-6-(4-hydroxy-3-methoxyphenyl)-8-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1,7,9-trien-4-one details
Cinchonain Id 7-glucoside → 6-(3,4-dihydroxyphenyl)-13-hydroxy-12-(4-hydroxy-3-methoxyphenyl)-8-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1,7,9-trien-4-one details
6,12-bis(3,4-dihydroxyphenyl)-8,13-dihydroxy-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-4-one → 12-(3,4-dihydroxyphenyl)-8,13-dihydroxy-6-(4-hydroxy-3-methoxyphenyl)-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-4-one details
6,12-bis(3,4-dihydroxyphenyl)-8,13-dihydroxy-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-4-one → 6-(3,4-dihydroxyphenyl)-8,13-dihydroxy-12-(4-hydroxy-3-methoxyphenyl)-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-4-one details
3,4-Dihydroxyphenyllactic acid methyl ester → methyl 2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propanoate details
2-[4,6-dihydroxy-2-methoxy-3-(3-methylbut-2-en-1-yl)phenyl]-1-(2,4,5-trihydroxyphenyl)ethan-1-one → 2-[4,6-dihydroxy-2-methoxy-3-(3-methylbut-2-en-1-yl)phenyl]-1-(2,4-dihydroxy-5-methoxyphenyl)ethan-1-one details
6-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-3-(3-methylbut-2-en-1-yl)benzene-1,2,4-triol → 5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-4-methoxy-2-(3-methylbut-2-en-1-yl)benzene-1,3-diol details
5-[(E)-2-[3,5-dihydroxy-4-(3-methylbut-2-en-1-yl)phenyl]ethenyl]benzene-1,2,4-triol → 5-[(E)-2-(2,4-dihydroxy-5-methoxyphenyl)ethenyl]-2-(3-methylbut-2-en-1-yl)benzene-1,3-diol details
1-(3,4-dihydroxyphenyl)-3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)prop-2-en-1-one → 1-(4-hydroxy-3-methoxyphenyl)-3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)prop-2-en-1-one details
1-(3,4-dihydroxyphenyl)-3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)propan-1-one → 1-(4-hydroxy-3-methoxyphenyl)-3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)propan-1-one details
Epicatechin-(4beta->6)-epicatechin-(2beta->7,4beta->8)-epicatechin → 5-(3,4-dihydroxyphenyl)-18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-13-(4-hydroxy-3-methoxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
Epicatechin-(4beta->6)-epicatechin-(2beta->7,4beta->8)-epicatechin → 5,13-bis(3,4-dihydroxyphenyl)-18-[3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
Epicatechin-(4beta->6)-epicatechin-(2beta->7,4beta->8)-epicatechin → 13-(3,4-dihydroxyphenyl)-18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-5-(4-hydroxy-3-methoxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
5-(3,4-dihydroxyphenyl)-18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-13-(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → 5-(3,4-dihydroxyphenyl)-13-(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
5-(3,4-dihydroxyphenyl)-18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-13-(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → 18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-5-(4-hydroxy-3-methoxyphenyl)-13-(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
5,13-bis(3,4-dihydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → 5-(3,4-dihydroxyphenyl)-13-(4-hydroxy-3-methoxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
5,13-bis(3,4-dihydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → 13-(3,4-dihydroxyphenyl)-5-(4-hydroxy-3-methoxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
13-(3,4-dihydroxyphenyl)-18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-5-(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → 18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-13-(4-hydroxy-3-methoxyphenyl)-5-(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
13-(3,4-dihydroxyphenyl)-18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-5-(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → 13-(3,4-dihydroxyphenyl)-5-(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
5-(3,4-dihydroxyphenyl)-13-(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → 5-(4-hydroxy-3-methoxyphenyl)-13-(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-5,13-bis(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → 5,13-bis(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
13-(3,4-dihydroxyphenyl)-5-(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → 13-(4-hydroxy-3-methoxyphenyl)-5-(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol details
3-(3,4-dihydroxy-2-methoxyphenyl)-1-(3,4-dihydroxyphenyl)propan-1-one → 3-(3,4-dihydroxy-2-methoxyphenyl)-1-(4-hydroxy-3-methoxyphenyl)propan-1-one details
3-(3,4-dihydroxy-2-methoxyphenyl)-1-(3-hydroxyphenyl)prop-2-en-1-one → 3-(4-hydroxy-2,3-dimethoxyphenyl)-1-(3-hydroxyphenyl)prop-2-en-1-one details
3-(3,4-dihydroxy-2-methoxyphenyl)-1-(3-hydroxyphenyl)propan-1-one → 3-(4-hydroxy-2,3-dimethoxyphenyl)-1-(3-hydroxyphenyl)propan-1-one details
6-(2,4-dihydroxyphenyl)-4-methyl-2-{2,3,6-trihydroxy-4-[6-hydroxy-7-(3-methylbut-2-en-1-yl)-1-benzofuran-2-yl]phenyl}cyclohex-3-ene-1-carboxylic acid → 2-{2,6-dihydroxy-4-[6-hydroxy-7-(3-methylbut-2-en-1-yl)-1-benzofuran-2-yl]-3-methoxyphenyl}-6-(2,4-dihydroxyphenyl)-4-methylcyclohex-3-ene-1-carboxylic acid details
2-{2,6-dihydroxy-4-[6-hydroxy-7-(3-methylbut-2-en-1-yl)-1-benzofuran-2-yl]phenyl}-4-methyl-6-(2,4,5-trihydroxyphenyl)cyclohex-3-ene-1-carboxylic acid → 2-{2,6-dihydroxy-4-[6-hydroxy-7-(3-methylbut-2-en-1-yl)-1-benzofuran-2-yl]phenyl}-6-(2,4-dihydroxy-5-methoxyphenyl)-4-methylcyclohex-3-ene-1-carboxylic acid details
3-(3-methylbut-2-en-1-yl)benzene-1,2,4-triol → 4-methoxy-2-(3-methylbut-2-en-1-yl)benzene-1,3-diol details
5-{6-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-3-methylcyclohex-3-en-1-yl}benzene-1,2,4-triol → 2-{6-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxy-5-methoxyphenyl)-3-methylcyclohex-2-en-1-yl}-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol details
3-{6-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl}-6-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,2,4-triol → 2-{6-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl}-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-4-methoxybenzene-1,3-diol details
5-[(E)-2-(4-{6-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl}-3,5-dihydroxyphenyl)ethenyl]benzene-1,2,4-triol → 2-{6-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl}-5-[(E)-2-(2,4-dihydroxy-5-methoxyphenyl)ethenyl]benzene-1,3-diol details
5-[6-(2,4-dihydroxyphenyl)-2-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-4-methylcyclohex-3-ene-1-carbonyl]-3-(3-methylbut-2-en-1-yl)benzene-1,2,4-triol → 2-{6-[2,4-dihydroxy-5-methoxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl}-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol details
6-{[2-(3,4-dihydroxyphenyl)-3,5-dihydroxy-4-oxo-4H-chromen-7-yl]oxy}-3,4,5-trihydroxyoxane-2-carboxylic acid → 6-{[3,5-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-4H-chromen-7-yl]oxy}-3,4,5-trihydroxyoxane-2-carboxylic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-4-one → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-4-one details
(+)-Catechin 6-C-glucoside → 2-(4-hydroxy-3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(2,5-dihydroxy-4-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
(+)-Catechin 8-C-glucoside → 2-(4-hydroxy-3-methoxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(3,4-dihydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol → 2-(4-hydroxy-3-methoxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol details
8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(2,4-dihydroxy-5-methoxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(2,5-dihydroxy-4-methoxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(4-hydroxy-3-methoxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → 2-(4-hydroxy-3-methoxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol details
5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one details
Lucenin 2,7-O-rhamnoside → 5-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-7-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-4-one details
5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → 2-(2,5-dihydroxy-4-methoxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one details
Isoswertiajaponin → Orientin 7,3'-dimethyl ether details
2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → 5-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one details
Maysin → Maysin 3'-methyl ether details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one → 6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one details
2-(3,4-dihydroxyphenyl)-3,5-dihydroxy-8,8-dimethyl-4H,8H-pyrano[2,3-f]chromen-4-one → 3,5-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-8,8-dimethyl-4H,8H-pyrano[2,3-f]chromen-4-one details
5-hydroxy-8,8-dimethyl-2-(2,4,5-trihydroxyphenyl)-4H,8H-pyrano[3,2-g]chromen-4-one → 2-(2,4-dihydroxy-5-methoxyphenyl)-5-hydroxy-8,8-dimethyl-4H,8H-pyrano[3,2-g]chromen-4-one details
3-methoxybenzene-1,2-diol → 2,6-Dimethoxyphenol details
Cyanidin 3-rhamnoside → Peonidin 3-rhamnoside details
Cyanidin 3-sambubioside → Peonidin 3-lathyroside details
Graveobioside A → Graveobioside B details
3-Galloylcatechin → 5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl 3,4,5-trihydroxybenzoate details
Quercetin 3-(6''-malonyl-glucoside) → Isorhamnetin 3-(6''-malonylglucoside) details
eq-4''-Hydroxymaysin → ax-4''-Hydroxy-3-'-methoxymaysin details
(2S,4S,6S)-2-[2-(4-Hydroxy-3-meyhoxyphenyl)ethyl]tetrahydro-6-(4,5-dihydroxy-3-methoxyphenyl)-2H-pyran-4-ol → (2S,4R,6S)-2-[2-(4-hydroxy-3-methoxyphenyl)ethyl]tetrahydro-6-(4-hydroxy-3,5-dimethoxyphenyl)-2H-pyran-4-ol details
GO Classification
Biological Process
small molecule metabolic process
estrogen metabolic process
multicellular organismal reproductive process
negative regulation of dopamine metabolic process
positive regulation of homocysteine metabolic process
response to pain
female pregnancy
response to lipopolysaccharide
neurotransmitter biosynthetic process
response to drug
xenobiotic metabolic process
negative regulation of smooth muscle cell proliferation
learning
dopamine catabolic process
neurotransmitter catabolic process
response to organic cyclic compound
Cellular Component
cytosol
mitochondrion
plasma membrane
intracellular membrane-bounded organelle
integral to membrane
Function
o-methyltransferase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
transferase activity
magnesium ion binding
catechol o-methyltransferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
catechol O-methyltransferase activity
O-methyltransferase activity
magnesium ion binding
Process
metabolic process
biological regulation
cellular metabolic process
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
cellular amino acid and derivative metabolic process
catecholamine metabolic process
regulation of biological quality
regulation of neurotransmitter levels
neurotransmitter metabolic process
neurotransmitter catabolic process
Cellular Location
  1. Single-pass type II membrane protein
  2. Isoform Membrane-bound:Cell membrane
  3. Extracellular side
Gene Properties
Chromosome Location 22
Locus 22q11.21
SNPs COMT
Gene Sequence
>816 bp
ATGCCGGAGGCCCCGCCTCTGCTGTTGGCAGCTGTGTTGCTGGGCCTGGTGCTGCTGGTG
GTGCTGCTGCTGCTTCTGAGGCACTGGGGCTGGGGCCTGTGCCTTATCGGCTGGAACGAG
TTCATCCTGCAGCCCATCCACAACCTGCTCATGGGTGACACCAAGGAGCAGCGCATCCTG
AACCACGTGCTGCAGCATGCGGAGCCCGGGAACGCACAGAGCGTGCTGGAGGCCATTGAC
ACCTACTGCGAGCAGAAGGAGTGGGCCATGAACGTGGGCGACAAGAAAGGCAAGATCGTG
GACGCCGTGATTCAGGAGCACCAGCCCTCCGTGCTGCTGGAGCTGGGGGCCTACTGTGGC
TACTCAGCTGTGCGCATGGCCCGCCTGCTGTCACCAGGGGCGAGGCTCATCACCATCGAG
ATCAACCCCGACTGTGCCGCCATCACCCAGCGGATGGTGGATTTCGCTGGCGTGAAGGAC
AAGGTCACCCTTGTGGTTGGAGCGTCCCAGGACATCATCCCCCAGCTGAAGAAGAAGTAT
GATGTGGACACACTGGACATGGTCTTCCTCGACCACTGGAAGGACCGGTACCTGCCGGAC
ACGCTTCTCTTGGAGGAATGTGGCCTGCTGCGGAAGGGGACAGTGCTACTGGCTGACAAC
GTGATCTGCCCAGGTGCGCCAGACTTCCTAGCACACGTGCGCGGGAGCAGCTGCTTTGAG
TGCACACACTACCAATCGTTCCTGGAATACAGGGAGGTGGTGGACGGCCTGGAGAAGGCC
ATCTACAAGGGCCCAGGCAGCGAAGCAGGGCCCTGA
Protein Properties
Number of Residues 271
Molecular Weight 30036.77
Theoretical pI 5.467
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Catechol O-methyltransferase
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
GenBank ID Protein 180920
UniProtKB/Swiss-Prot ID P21964
UniProtKB/Swiss-Prot Entry Name COMT_HUMAN
PDB IDs
GenBank Gene ID M65212
GeneCard ID COMT
GenAtlas ID COMT
HGNC ID HGNC:2228
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  4. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  5. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209 ]
  6. Lundstrom K, Salminen M, Jalanko A, Savolainen R, Ulmanen I: Cloning and characterization of human placental catechol-O-methyltransferase cDNA. DNA Cell Biol. 1991 Apr;10(3):181-9. [PubMed:1707278 ]
  7. Bertocci B, Miggiano V, Da Prada M, Dembic Z, Lahm HW, Malherbe P: Human catechol-O-methyltransferase: cloning and expression of the membrane-associated form. Proc Natl Acad Sci U S A. 1991 Feb 15;88(4):1416-20. [PubMed:1847521 ]
  8. Tenhunen J, Salminen M, Lundstrom K, Kiviluoto T, Savolainen R, Ulmanen I: Genomic organization of the human catechol O-methyltransferase gene and its expression from two distinct promoters. Eur J Biochem. 1994 Aug 1;223(3):1049-59. [PubMed:8055944 ]
  9. Vilbois F, Caspers P, da Prada M, Lang G, Karrer C, Lahm HW, Cesura AM: Mass spectrometric analysis of human soluble catechol O-methyltransferase expressed in Escherichia coli. Identification of a product of ribosomal frameshifting and of reactive cysteines involved in S-adenosyl-L-methionine binding. Eur J Biochem. 1994 Jun 1;222(2):377-86. [PubMed:8020475 ]
  10. Tilgmann C, Kalkkinen N: Purification and partial sequence analysis of the soluble catechol-O-methyltransferase from human placenta: comparison to the rat liver enzyme. Biochem Biophys Res Commun. 1991 Jan 31;174(2):995-1002. [PubMed:1993083 ]
  11. Ulmanen I, Lundstrom K: Cell-free synthesis of rat and human catechol O-methyltransferase. Insertion of the membrane-bound form into microsomal membranes in vitro. Eur J Biochem. 1991 Dec 18;202(3):1013-20. [PubMed:1765063 ]
  12. Rutherford K, Le Trong I, Stenkamp RE, Parson WW: Crystal structures of human 108V and 108M catechol O-methyltransferase. J Mol Biol. 2008 Jun 27;380(1):120-30. doi: 10.1016/j.jmb.2008.04.040. Epub 2008 Apr 23. [PubMed:18486144 ]
  13. Lachman HM, Papolos DF, Saito T, Yu YM, Szumlanski CL, Weinshilboum RM: Human catechol-O-methyltransferase pharmacogenetics: description of a functional polymorphism and its potential application to neuropsychiatric disorders. Pharmacogenetics. 1996 Jun;6(3):243-50. [PubMed:8807664 ]
  14. Tiihonen J, Hallikainen T, Lachman H, Saito T, Volavka J, Kauhanen J, Salonen JT, Ryynanen OP, Koulu M, Karvonen MK, Pohjalainen T, Syvalahti E, Hietala J: Association between the functional variant of the catechol-O-methyltransferase (COMT) gene and type 1 alcoholism. Mol Psychiatry. 1999 May;4(3):286-9. [PubMed:10395222 ]
  15. Lee SG, Joo Y, Kim B, Chung S, Kim HL, Lee I, Choi B, Kim C, Song K: Association of Ala72Ser polymorphism with COMT enzyme activity and the risk of schizophrenia in Koreans. Hum Genet. 2005 Mar;116(4):319-28. Epub 2005 Jan 12. [PubMed:15645182 ]
  16. Rutherford K, Alphandery E, McMillan A, Daggett V, Parson WW: The V108M mutation decreases the structural stability of catechol O-methyltransferase. Biochim Biophys Acta. 2008 Jul-Aug;1784(7-8):1098-105. doi: 10.1016/j.bbapap.2008.04.006. Epub 2008 Apr 24. [PubMed:18474266 ]
  17. Annerbrink K, Westberg L, Nilsson S, Rosmond R, Holm G, Eriksson E: Catechol O-methyltransferase val158-met polymorphism is associated with abdominal obesity and blood pressure in men. Metabolism. 2008 May;57(5):708-11. doi: 10.1016/j.metabol.2008.01.012. [PubMed:18442637 ]