You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00339
Secondary Accession Numbers
  • 5575
Name Heparan sulfate glucosamine 3-O-sulfotransferase 3B1
Synonyms
  1. 3-OST-3B
  2. Heparan sulfate 3-O-sulfotransferase 3B1
  3. Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1
  4. h3-OST-3B
Gene Name HS3ST3B1
Protein Type Enzyme
Biological Properties
General Function Involved in sulfotransferase activity
Specific Function Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N-unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate. Catalyzes the O-sulfation of glucosamine in IdoUA2S-GlcNS and also in IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.
Pathways
  • Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Reactions
Phosphoadenosine phosphosulfate + [heparan sulfate]-glucosamine → Adenosine 3',5'-diphosphate + [heparan sulfate]-glucosamine 3-sulfate details
GO Classification
Biological Process
glycosaminoglycan biosynthetic process
heparan sulfate proteoglycan biosynthetic process, enzymatic modification
carbohydrate metabolic process
Cellular Component
Golgi membrane
integral to plasma membrane
Function
catalytic activity
transferase activity
transferase activity, transferring sulfur-containing groups
sulfotransferase activity
Molecular Function
[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity
[heparan sulfate]-glucosamine 3-sulfotransferase 3 activity
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein (Probable)
Gene Properties
Chromosome Location 17
Locus 17p12
SNPs HS3ST3B1
Gene Sequence
>1173 bp
ATGGGGCAGCGCCTGAGTGGCGGCAGATCTTGCCTCGATGTCCCCGGCCGGCTCCTACCG
CAGCCGCCGCCGCCCCCGCCGCCGGTGAGGAGGAAGCTCGCGCTGCTCTTCGCCATGCTC
TGCGTCTGGCTCTATATGTTCCTGTACTCGTGCGCCGGCTCCTGCGCCGCCGCGCCGGGG
CTGCTGCTCCTGGGCTCTGGGTCCCGCGCCGCACACGACCCGCCAGCCCTGGCCACAGCT
CCGGACGGGACGCCCCCCAGGCTGCCGTTCCGGGCGCCGCCAGCCACCCCACTGGCTTCA
GGCAAGGAGATGGCCGAGGGCGCTGCGAGCCCGGAGGAGCAGAGTCCCGAGGTGCCGGAC
TCCCCAAGCCCCATCTCCAGCTTTTTCAGTGGGTCTGGGAGCAAGCAGCTGCCGCAGGCC
ATCATCATCGGCGTGAAGAAGGGCGGCACGCGGGCGCTGCTGGAGTTTCTGCGCGTGCAC
CCCGACGTGCGCGCCGTGGGCGCCGAGCCCCATTTCTTCGATCGCAGCTACGACAAGGGC
CTCGCTTGGTACCGGGACCTGATGCCCAGAACCCTGGACGGGCAGATCACCATGGAGAAG
ACGCCCAGTTACTTCGTCACGCGGGAGGCCCCCGCGCGCATCTCGGCCATGTCCAAGGAC
ACCAAGCTCATCGTGGTGGTGCGGGACCCGGTGACCAGGGCCATCTCGGACTACACGCAG
ACGCTGTCCAAGCGGCCCGACATCCCCACCTTCGAGAGCTTGACGTTCAAAAACAGGACA
GCGGGCCTCATCGACACGTCGTGGAGCGCCATCCAGATCGGCATCTACGCCAAGCACCTG
GAGCACTGGCTGCGCCACTTCCCCATCCGCCAGATGCTCTTCGTGAGCGGCGAGCGGCTC
ATCAGCGACCCGGCCGGGGAGCTGGGCCGCGTGCAAGACTTCCTGGGCCTCAAGAGGATC
ATCACGGACAAGCACTTCTACTTCAACAAGACCAAGGGCTTCCCCTGCCTGAAGAAGGCG
GAGGGCAGCAGCCGGCCCCATTGCCTGGGCAAGACCAAGGGCAGGACCCATCCTGAGATC
GACCGCGAGGTGGTGCGCAGGCTGCGCGAGTTCTACCGGCCTTTCAACCTCAAGTTCTAC
CAGATGACCGGGCACGACTTTGGCTGGGATTGA
Protein Properties
Number of Residues 390
Molecular Weight 43323.605
Theoretical pI 9.632
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Heparan sulfate glucosamine 3-O-sulfotransferase 3B1
MGQRLSGGRSCLDVPGRLLPQPPPPPPPVRRKLALLFAMLCVWLYMFLYSCAGSCAAAPG
LLLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPD
SPSPISSFFSGSGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKG
LAWYRDLMPRTLDGQITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQ
TLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERL
ISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLGKTKGRTHPEI
DREVVRRLREFYRPFNLKFYQMTGHDFGWD
GenBank ID Protein 4835725
UniProtKB/Swiss-Prot ID Q9Y662
UniProtKB/Swiss-Prot Entry Name HS3SB_HUMAN
PDB IDs Not Available
GenBank Gene ID AF105377
GeneCard ID HS3ST3B1
GenAtlas ID HS3ST3B1
HGNC ID HGNC:5198
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Shworak NW, Liu J, Petros LM, Zhang L, Kobayashi M, Copeland NG, Jenkins NA, Rosenberg RD: Multiple isoforms of heparan sulfate D-glucosaminyl 3-O-sulfotransferase. Isolation, characterization, and expression of human cdnas and identification of distinct genomic loci. J Biol Chem. 1999 Feb 19;274(8):5170-84. [PubMed:9988767 ]
  4. Shukla D, Liu J, Blaiklock P, Shworak NW, Bai X, Esko JD, Cohen GH, Eisenberg RJ, Rosenberg RD, Spear PG: A novel role for 3-O-sulfated heparan sulfate in herpes simplex virus 1 entry. Cell. 1999 Oct 1;99(1):13-22. [PubMed:10520990 ]
  5. Liu J, Shworak NW, Sinay P, Schwartz JJ, Zhang L, Fritze LM, Rosenberg RD: Expression of heparan sulfate D-glucosaminyl 3-O-sulfotransferase isoforms reveals novel substrate specificities. J Biol Chem. 1999 Feb 19;274(8):5185-92. [PubMed:9988768 ]