Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00366
Secondary Accession Numbers
  • 5602
Name Neutral alpha-glucosidase AB
Synonyms
  1. Alpha-glucosidase 2
  2. Glucosidase II subunit alpha
Gene Name GANAB
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.
Pathways
  • N-Glycan biosynthesis
  • N-glycan metabolism
  • Protein processing in endoplasmic reticulum
Reactions
Water + → D-Glucose + details
Water + → D-Glucose + details
GO Classification
Biological Process
protein folding
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
endoplasmic reticulum lumen
Golgi apparatus
melanosome
glucosidase II complex
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
Molecular Function
carbohydrate binding
glucan 1,3-alpha-glucosidase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Melanosome
  2. Golgi apparatus
  3. Endoplasmic reticulum
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GANAB
Gene Sequence
>2835 bp
ATGGCGGCGGTAGCGGCAGTGGCGGCGCGTAGGAGGCGGTCTTGGGCGTCTTTGGTACTG
GCTTTTTTAGGGGTCTGCCTGGGGATTACCCTTGCTGTGGATAGAAGCAACTTTAAGACC
TGTGAAGAGAGTTCTTTCTGCAAGCGACAGAGAAGCATACGGCCAGGCCTCTCTCCATAC
CGAGCCTTGCTGGACTCTCTACAGCTTGGTCCTGATTCCCTCACGGTCCATCTGATCCAT
GAGGTCACCAAGGTGTTGCTGGTGCTAGAGCTTCAGGGGCTTCAAAAGAACATGACTCGG
TTCAGGATTGATGAGCTGGAGCCTCGGCGACCCCGATACCGTGTACCAGATGTTTTGGTG
GCTGATCCACCAATAGCCCGGCTTTCTGTCTCTGGTCGTGATGAGAACAGTGTGGAGTTA
ACCATGGCTGAGGGACCCTACAAGATCATCTTGACAGCACGGCCATTCCGCCTTGACCTA
CTAGAGGACCGAAGTCTTTTGCTTAGTGTCAATGCCCGAGGACTCTTGGAGTTTGAGCAT
CAGAGGGCCCCTAGGGTCTCGCAAGGATCAAAAGACCCAGCTGAGGGCGATGGGGCCCAG
CCTGAGGAAACACCCAGGGATGGCGACAAGCCAGAGGAGACTCAGGGGAAGGCAGAGAAA
GATGAGCCAGGAGCCTGGGAGGAGACATTCAAAACTCACTCTGACAGCAAGCCGTATGGC
CCCATGTCTGTGGGTTTGGACTTCTCTCTGCCAGGCATGGAGCATGTCTATGGGATCCCT
GAGCATGCAGACAACCTGAGGCTGAAGGTCACTGAGGGTGGGGAGCCATATCGCCTCTAC
AATTTGGATGTGTTCCAGTATGAGCTGTACAACCCAATGGCCTTGTATGGGTCTGTGCCT
GTGCTCCTGGCACACAACCCTCATCGCGACTTGGGCATCTTCTGGCTCAATGCTGCAGAG
ACCTGGGTTGATATATCTTCCAACACTGCCGGGAAGACCCTGTTTGGGAAGATGATGGAC
TACCTGCAGGGCTCTGGGGAGACCCCACAGACAGATGTTCGCTGGATGTCAGAGACTGGC
ATCATTGACGTCTTCCTGCTGCTGGGGCCCTCCATCTCTGATGTTTTCCGGCAATATGCT
AGTCTCACAGGAACCCAGGCGTTGCCCCCACTCTTCTCCCTCGGCTACCACCAGAGCCGT
TGGAACTACCGGGACGAGGCTGATGTGCTGGAAGTGGATCAGGGCTTTGATGATCACAAC
CTGCCCTGTGATGTCATCTGGCTAGACATTGAACATGCTGATGGCAAGCGGTATTTCACC
TGGGACCCCAGTCGCTTCCCTCAGCCCCGCACCATGCTTGAGCGCTTGGCTTCTAAGAGG
CGGAAGCTGGTGGCCATCGTAGACCCCCACATCAAGGTGGACTCCGGCTACCGAGTTCAC
GAGGAGCTGCGGAACCTGGGGCTGTATGTTAAAACCCGGGATGGCTCTGACTATGAGGGC
TGGTGCTGGCCAGGCTCAGCTGGTTACCCTGACTTCACTAATCCCACGATGAGGGCCTGG
TGGGCTAACATGTTCAGCTATGACAATTATGAGGGCTCAGCTCCCAACCTCTTTGTCTGG
AATGACATGAACGAACCATCTGTGTTCAATGGTCCTGAGGTCACCATGCTCAAGGATGCC
CAGCATTATGGGGGCTGGGAGCACCGGGATGTGCATAACATCTATGGCCTTTATGTGCAC
ATGGCGACTGCTGATGGGCTGAGACAGCGCTCTGGGGGCATGGAACGCCCCTTTGTCCTG
GCCAGGGCCTTCTTCGCTGGCTCCCAGCGCTTTGGAGCCGTGTGGACAGGGGACAACACT
GCCGAGTGGGACCATTTGAAGATCTCTATTCCTATGTGTCTCAGCTTGGGGCTGGTGGGA
CTTTCCTTCTGTGGGGCGGATGTGGGTGGCTTCTTCAAAAACCCAGAGCCAGAGCTGCTT
GTGCGCTGGTACCAGATGGGTGCTTACCAGCCATTCTTCCGGGCACATGCCCACTTGGAC
ACTGGGCGACGAGAGCCATGGCTGTTACCATCTCAGCACAATGATATAATCCGAGATGCC
TTGGGCCAGCGATATTCTTTGCTGCCCTTCTGGTACACCCTCTTATATCAGGCCCATCGG
GAAGGCATTCCTGTCATGAGGCCCCTGTGGGTGCAGTACCCTCAGGATGTGACTACCTTC
AATATAGATGATCAGTACTTGCTTGGGGATGCGTTGCTGGTTCACCCTGTATCAGACTCT
GGAGCCCATGGTGTCCAGGTCTATCTGCCTGGCCAAGGGGAGGTGTGGTATGACATTCAA
AGCTACCAGAAGCATCATGGTCCCCAGACCCTGTACCTGCCTGTAACTCTAAGCAGTATC
CCTGTGTTCCAGCGTGGAGGGACAATCGTGCCTCGATGGATGCGAGTGCGGCGGTCTTCA
GAATGTATGAAGGATGACCCCATCACTCTCTTTGTTGCACTTAGCCCTCAGGGTACAGCT
CAAGGAGAGCTCTTTCTGGATGATGGGCACACGTTCAACTATCAGACTCGCCAAGAGTTC
CTGCTGCGTCGATTCTCATTCTCTGGCAACACCCTTGTCTCCAGCTCAGCAGACCCTGAA
GGACACTTTGAGACACCAATCTGGATTGAGCGGGTGGTGATAATAGGGGCTGGAAAGCCA
GCAGCTGTGGTACTCCAGACAAAAGGATCTCCAGAAAGCCGCCTGTCCTTCCAGCATGAC
CCTGAGACCTCTGTGTTGGTCCTGCGCAAGCCTGGCATCAATGTGGCATCTGATTGGAGT
ATTCACCTGCGATAA
Protein Properties
Number of Residues 944
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Neutral alpha-glucosidase AB
MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPY
RALLDSLQLGPDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLV
ADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEH
QRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYG
PMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLYNLDVFQYELYNPMALYGSVP
VLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQTDVRWMSETG
IIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN
LPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVH
EELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVW
NDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVL
ARAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGLVGLSFCGADVGGFFKNPEPELL
VRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHR
EGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQ
SYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTA
QGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKP
AAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR
GenBank ID Protein 38202257
UniProtKB/Swiss-Prot ID Q14697
UniProtKB/Swiss-Prot Entry Name GANAB_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_198334.1
GeneCard ID GANAB
GenAtlas ID GANAB
HGNC ID HGNC:4138
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF: Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes. J Proteome Res. 2006 Nov;5(11):3135-44. [PubMed:17081065 ]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  4. Nagase T, Miyajima N, Tanaka A, Sazuka T, Seki N, Sato S, Tabata S, Ishikawa K, Kawarabayasi Y, Kotani H, et al.: Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1995;2(1):37-43. [PubMed:7788527 ]
  5. Pelletier MF, Marcil A, Sevigny G, Jakob CA, Tessier DC, Chevet E, Menard R, Bergeron JJ, Thomas DY: The heterodimeric structure of glucosidase II is required for its activity, solubility, and localization in vivo. Glycobiology. 2000 Aug;10(8):815-27. [PubMed:10929008 ]
  6. Martiniuk F, Ellenbogen A, Hirschhorn R: Identity of neutral alpha-glucosidase AB and the glycoprotein processing enzyme glucosidase II. Biochemical and genetic studies. J Biol Chem. 1985 Jan 25;260(2):1238-42. [PubMed:3881423 ]
  7. Trombetta ES, Simons JF, Helenius A: Endoplasmic reticulum glucosidase II is composed of a catalytic subunit, conserved from yeast to mammals, and a tightly bound noncatalytic HDEL-containing subunit. J Biol Chem. 1996 Nov 1;271(44):27509-16. [PubMed:8910335 ]