You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00440
Secondary Accession Numbers
  • 5678
Name Non-specific lipid-transfer protein
Synonyms
  1. NSL-TP
  2. Propanoyl-CoA C-acyltransferase
  3. SCP-2
  4. SCP-X
  5. SCP-chi
  6. SCPX
  7. Sterol carrier protein 2
  8. Sterol carrier protein X
Gene Name SCP2
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.
Pathways
  • 27-Hydroxylase Deficiency
  • Bile Acid Biosynthesis
  • Cerebrotendinous Xanthomatosis (CTX)
  • Congenital Bile Acid Synthesis Defect Type II
  • Congenital Bile Acid Synthesis Defect Type III
  • Familial Hypercholanemia (FHCA)
  • Peroxisome
  • PPAR signaling pathway
  • Primary bile acid biosynthesis
  • Zellweger Syndrome
Reactions
3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholanoyl-CoA + Propionyl-CoA → Coenzyme A + 3-alpha,7-alpha,12-alpha-trihydroxy-24-oxo-5-beta-cholestanoyl-CoA details
Propionyl-CoA + Choloyl-CoA → Coenzyme A + 3a,7a,12a-Trihydroxy-5b-24-oxocholestanoyl-CoA details
Propionyl-CoA + Chenodeoxycholoyl-CoA → Coenzyme A + 3a,7a-Dihydroxy-5b-24-oxocholestanoyl-CoA details
GO Classification
Biological Process
bile acid biosynthetic process
progesterone biosynthetic process
alpha-linolenic acid metabolic process
fatty acid beta-oxidation using acyl-CoA oxidase
lipid transport
inositol trisphosphate biosynthetic process
lipid hydroperoxide transport
peroxisome organization
positive regulation of intracellular cholesterol transport
positive regulation of steroid metabolic process
protein localization to plasma membrane
Cellular Component
cytoplasm
mitochondrion
nucleus
peroxisomal matrix
protein complex
Function
binding
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
oxidoreductase activity
steroid binding
sterol binding
lipid binding
Molecular Function
cholesterol binding
long-chain fatty acyl-CoA binding
oleic acid binding
phosphatidylinositol transporter activity
propanoyl-CoA C-acyltransferase activity
transferase activity, transferring acyl groups other than amino-acyl groups
sterol binding
Process
metabolic process
Cellular Location
  1. Isoform SCP2:Mitochondrion (Probable)
Gene Properties
Chromosome Location 1
Locus 1p32
SNPs SCP2
Gene Sequence
>1644 bp
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGC
ATGACCAAGTTTGTGAAGCCTGGAGCTGAGAATTCAAGAGACTACCCTGACTTGGCAGAA
GAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCA
TGTGTTGGCTATGTTTTTGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTG
GGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCT
TTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGG
TTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACT
GATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCT
CAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACAC
TTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTC
CAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACT
ATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCA
TTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATG
ACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATG
AGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGAC
GTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTGACTTATGAAGCACTCGGA
CTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGA
AAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACA
GGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAA
GTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTA
ACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAA
GCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATT
GAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCC
TTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAAT
GGCAAAGGATCAGTGCTTCCTAACTCAGATAAGAAGGCTGACTGCACAATCACAATGGCT
GACTCAGACTTCCTGGCTTTAATGACTGGTAAAATGAATCCTCAGTCGGCCTTCTTTCAA
GGCAAATTGAAAATCACTGGCAACATGGGTCTCGCTATGAAGTTACAAAATCTTCAGCTT
CAGCCAGGCAACGCTAAGCTCTGA
Protein Properties
Number of Residues 547
Molecular Weight 34974.505
Theoretical pI 5.658
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Non-specific lipid-transfer protein
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQA
CVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALG
FEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEH
FAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEA
FVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDID
VIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIE
AVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKN
GKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQL
QPGNAKL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P22307
UniProtKB/Swiss-Prot Entry Name NLTP_HUMAN
PDB IDs
GenBank Gene ID M75883
GeneCard ID SCP2
GenAtlas ID SCP2
HGNC ID HGNC:10606
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  6. Ohba T, Rennert H, Pfeifer SM, He Z, Yamamoto R, Holt JA, Billheimer JT, Strauss JF 3rd: The structure of the human sterol carrier protein X/sterol carrier protein 2 gene (SCP2). Genomics. 1994 Nov 15;24(2):370-4. [PubMed:7698762 ]
  7. He Z, Yamamoto R, Furth EE, Schantz LJ, Naylor SL, George H, Billheimer JT, Strauss JF 3rd: cDNAs encoding members of a family of proteins related to human sterol carrier protein 2 and assignment of the gene to human chromosome 1 p21----pter. DNA Cell Biol. 1991 Oct;10(8):559-69. [PubMed:1718316 ]
  8. Yamamoto R, Kallen CB, Babalola GO, Rennert H, Billheimer JT, Strauss JF 3rd: Cloning and expression of a cDNA encoding human sterol carrier protein 2. Proc Natl Acad Sci U S A. 1991 Jan 15;88(2):463-7. [PubMed:1703300 ]
  9. Yamamoto R: [Localization of human sterol carrier protein 2 gene and cDNA expression in COS-7 cell]. Hokkaido Igaku Zasshi. 1992 Nov;67(6):839-48. [PubMed:1483685 ]
  10. Seedorf U, Scheek S, Engel T, Steif C, Hinz HJ, Assmann G: Structure-activity studies of human sterol carrier protein 2. J Biol Chem. 1994 Jan 28;269(4):2613-8. [PubMed:8300590 ]
  11. Szyperski T, Scheek S, Johansson J, Assmann G, Seedorf U, Wuthrich K: NMR determination of the secondary structure and the three-dimensional polypeptide backbone fold of the human sterol carrier protein 2. FEBS Lett. 1993 Nov 29;335(1):18-26. [PubMed:8243660 ]
  12. Stanley WA, Filipp FV, Kursula P, Schuller N, Erdmann R, Schliebs W, Sattler M, Wilmanns M: Recognition of a functional peroxisome type 1 target by the dynamic import receptor pex5p. Mol Cell. 2006 Dec 8;24(5):653-63. [PubMed:17157249 ]