You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00767
Secondary Accession Numbers
  • 6044
Name N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
Synonyms
  1. DDAH-1
  2. DDAHI
  3. Dimethylargininase-1
  4. Dimethylarginine dimethylaminohydrolase 1
Gene Name DDAH1
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
Specific Function Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
Pathways Not Available
Reactions
Asymmetric dimethylarginine + Water → Dimethylamine + Citrulline details
GO Classification
Biological Process
citrulline metabolic process
nitric oxide mediated signal transduction
regulation of systemic arterial blood pressure
positive regulation of nitric oxide biosynthetic process
positive regulation of angiogenesis
arginine catabolic process
Cellular Component
mitochondrion
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Molecular Function
metal ion binding
dimethylargininase activity
amino acid binding
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 1
Locus 1p22
SNPs DDAH1
Gene Sequence
>858 bp
ATGGCCGGGCTCGGCCACCCCGCCGCCTTCGGCCGGGCCACCCACGCCGTGGTGCGGGCG
CTACCCGAGTCGCTCGGCCAGCACGCGCTGAGAAGCGCCAAGGGCGAGGAGGTGGACGTC
GCCCGCGCGGAACGGCAGCACCAGCTCTACGTGGGCGTGCTGGGCAGCAAGCTGGGGCTG
CAGGTGGTGGAGCTGCCGGCCGACGAGAGCCTTCCGGACTGCGTCTTCGTGGAGGACGTG
GCCGTGGTGTGCGAGGAGACGGCCCTCATCACCCGACCCGGGGCGCCGAGCCGGAGGAAG
GAGGTTGACATGATGAAAGAAGCATTAGAAAAACTTCAGCTCAATATAGTAGAGATGAAA
GATGAAAATGCAACTTTAGATGGCGGAGATGTTTTATTCACAGGCAGAGAATTTTTTGTG
GGCCTTTCCAAAAGGACAAATCAACGAGGTGCTGAAATCTTGGCTGATACTTTTAAGGAC
TATGCAGTCTCCACAGTGCCAGTGGCAGATGGGTTGCATTTGAAGAGTTTCTGCAGCATG
GCTGGGCCTAACCTGATCGCAATTGGGTCTAGTGAATCTGCACAGAAGGCCCTTAAGATC
ATGCAACAGATGAGTGACCACCGCTACGACAAACTCACTGTGCCTGATGACATAGCAGCA
AACTGTATATATCTAAATATCCCCAACAAAGGGCACGTCTTGCTGCACCGAACCCCGGAA
GAGTATCCAGAAAGTGCAAAGGTTTATGAGAAACTGAAGGACCATATGCTGATCCCCGTG
AGCATGTCTGAACTGGAAAAGGTGGATGGGCTGCTCACCTGCTGCTCAGTTTTAATTAAC
AAGAAAGTAGACTCCTGA
Protein Properties
Number of Residues 285
Molecular Weight 20189.135
Theoretical pI 5.84
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGL
QVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O94760
UniProtKB/Swiss-Prot Entry Name DDAH1_HUMAN
PDB IDs
GenBank Gene ID AB001915
GeneCard ID DDAH1
GenAtlas ID DDAH1
HGNC ID HGNC:2715
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Kimoto M, Miyatake S, Sasagawa T, Yamashita H, Okita M, Oka T, Ogawa T, Tsuji H: Purification, cDNA cloning and expression of human NG,NG-dimethylarginine dimethylaminohydrolase. Eur J Biochem. 1998 Dec 1;258(2):863-8. [PubMed:9874257 ]
  4. Leiper JM, Santa Maria J, Chubb A, MacAllister RJ, Charles IG, Whitley GS, Vallance P: Identification of two human dimethylarginine dimethylaminohydrolases with distinct tissue distributions and homology with microbial arginine deiminases. Biochem J. 1999 Oct 1;343 Pt 1:209-14. [PubMed:10493931 ]
  5. Forbes SP, Druhan LJ, Guzman JE, Parinandi N, Zhang L, Green-Church KB, Cardounel AJ: Mechanism of 4-HNE mediated inhibition of hDDAH-1: implications in no regulation. Biochemistry. 2008 Feb 12;47(6):1819-26. doi: 10.1021/bi701659n. Epub 2008 Jan 3. [PubMed:18171027 ]
  6. Leiper J, Nandi M, Torondel B, Murray-Rust J, Malaki M, O'Hara B, Rossiter S, Anthony S, Madhani M, Selwood D, Smith C, Wojciak-Stothard B, Rudiger A, Stidwill R, McDonald NQ, Vallance P: Disruption of methylarginine metabolism impairs vascular homeostasis. Nat Med. 2007 Feb;13(2):198-203. Epub 2007 Feb 4. [PubMed:17273169 ]
  7. Wang Y, Monzingo AF, Hu S, Schaller TH, Robertus JD, Fast W: Developing dual and specific inhibitors of dimethylarginine dimethylaminohydrolase-1 and nitric oxide synthase: toward a targeted polypharmacology to control nitric oxide. Biochemistry. 2009 Sep 15;48(36):8624-35. doi: 10.1021/bi9007098. [PubMed:19663506 ]