You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00907
Secondary Accession Numbers
  • 6195
  • HMDBP04430
Name UDP-glucose 6-dehydrogenase
Synonyms
  1. UDP-Glc dehydrogenase
  2. UDP-GlcDH
  3. UDPGDH
Gene Name UGDH
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Involved in the biosynthesis of glycosaminoglycans; hyaluronan, chondroitin sulfate, and heparan sulfate.
Pathways
  • Amino sugar and nucleotide sugar metabolism
  • Ascorbate and aldarate metabolism
  • Galactosemia II (GALK)
  • Galactosemia III
  • Glycogen synthetase deficiency
  • Glycogenosis, Type III. Cori disease, Debrancher glycogenosis
  • Glycogenosis, Type IV. Amylopectinosis, Anderson disease
  • Glycogenosis, Type VI. Hers disease
  • Mucopolysaccharidosis VI. Sly syndrome
  • Nucleotide Sugars Metabolism
  • Pentose and glucuronate interconversions
  • Starch and sucrose metabolism
  • Starch and Sucrose Metabolism
  • Sucrase-isomaltase deficiency
  • UDP-alpha-D-glucuronate biosynthesis
Reactions
Uridine diphosphate glucose + NAD + Water → Uridine diphosphate glucuronic acid + NADH details
Uridine diphosphate glucose + Water + NAD → Uridine diphosphate glucuronic acid + NADH + Hydrogen Ion details
GO Classification
Biological Process
glycosaminoglycan biosynthetic process
UDP-glucuronate biosynthetic process
gastrulation with mouth forming second
xenobiotic metabolic process
UDP-glucose metabolic process
Cellular Component
cytosol
Function
binding
nucleotide binding
catalytic activity
nad or nadh binding
oxidoreductase activity, acting on the ch-oh group of donors, nad or nadp as acceptor
oxidoreductase activity, acting on ch-oh group of donors
oxidoreductase activity
Molecular Function
electron carrier activity
NAD binding
UDP-glucose 6-dehydrogenase activity
Process
metabolic process
oxidation reduction
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4p15.1
SNPs UGDH
Gene Sequence
>1485 bp
ATGTTTGAAATTAAGAAGATCTGTTGCATCGGTGCAGGCTATGTTGGAGGACCCACATGT
AGTGTCATTGCTCATATGTGTCCTGAAATCAGGGTAACGGTTGTTGATGTCAATGAATCA
AGAATCAATGCGTGGAATTCTCCTACACTTCCTATTTATGAGCCAGGACTAAAAGAAGTG
GTAGAATCCTGTCGAGGAAAAAATCTTTTTTTTTCTACCAATATTGATGATGCCATCAAA
GAAGCTGATCTTGTATTTATTTCTGTGAATACTCCAACAAAAACCTATGGAATGGGGAAA
GGCCGGGCAGCAGATCTGAAGTATATTGAAGCTTGTGCTAGACGCATTGTGCAAAACTCA
AATGGGTACAAAATTGTGACTGAGAAAAGCACAGTTCCAGTGCGGGCAGCAGAAAGTATC
CGTCGCATATTTGATGCAAACACAAAACCCAACTTGAATTTACAGGTGCTGTCCAACCCT
GAGTTTCTGGCAGAGGGAACAGCCATCAAGGACCTAAAGAACCCAGACAGAGTACTGATT
GGAGGGGATGAAACTCCAGAGGGCCAGAGAGCTGTGCAGGCCCTGTGTGCTGTATATGAG
CACTGGGTTCCCAGAGAAAAGATCCTCACCACTAATACTTGGTCTTCAGAGCTTTCCAAA
CTGGCAGCAAATGCTTTTCTTGCCCAGAGAATAAGCAGCATTAACTCCATAAGTGCTCTG
TGTGAAGCAACAGGAGCTGATGTAGAAGAGGTAGCAACAGCGATTGGAATGGACCAGAGA
ATTGGAAACAAGTTTCTAAAAGCCAGTGTTGGGTTTGGTGGGAGCTGTTTCCAAAAGGAT
GTTCTGAATTTGGTTTATCTCTGTGAGGCTCTGAATTTGCCAGAAGTAGCTCGTTATTGG
CAGCAGGTCATAGACATGAATGACTACCAGAGGAGGAGGTTTGCTTCCCGGATCATAGAT
AGTCTGTTTAATACAGTAACTGATAAGAAGATAGCTATTTTGGGATTTGCATTCAAAAAG
GACACTGGTGATACAAGAGAATCTTCTAGTATATATATTAGCAAATATTTGATGGATGAA
GGTGCACATCTACATATATATGATCCAAAAGTACCTAGGGAACAAATAGTTGTGGATCTT
TCTCATCCAGGTGTTTCAGAGGATGACCAAGTGTCCCGGCTCGTGACCATTTCCAAGGAT
CCATATGAAGCATGTGATGGTGCCCATGCTGTTGTTATTTGCACTGAGTGGGACATGTTT
AAGGAATTGGATTATGAACGCATTCATAAAAAAATGCTAAAGCCAGCCTTTATCTTCGAT
GGACGGCGTGTCCTGGATGGGCTCCACAATGAACTACAAACCATTGGCTTCCAGATTGAA
ACAATTGGCAAAAAGGTGTCTTCAAAGAGAATTCCATATGCTCCTTCTGGTGAAATTCCG
AAGTTTAGTCTTCAAGATCCACCTAACAAGAAACCTAAAGTGTAG
Protein Properties
Number of Residues 494
Molecular Weight 47602.08
Theoretical pI 5.919
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>UDP-glucose 6-dehydrogenase
MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEV
VESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNS
NGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLI
GGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISAL
CEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYW
QQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDE
GAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF
KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIP
KFSLQDPPNKKPKV
GenBank ID Protein 3127127
UniProtKB/Swiss-Prot ID O60701
UniProtKB/Swiss-Prot Entry Name UGDH_HUMAN
PDB IDs
GenBank Gene ID AF061016
GeneCard ID UGDH
GenAtlas ID UGDH
HGNC ID HGNC:12525
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Spicer AP, Kaback LA, Smith TJ, Seldin MF: Molecular cloning and characterization of the human and mouse UDP-glucose dehydrogenase genes. J Biol Chem. 1998 Sep 25;273(39):25117-24. [PubMed:9737970 ]
  4. Peng HL, Lou MD, Chang ML, Chang HY: cDNA cloning and expression analysis of the human UDPglucose dehydrogenase. Proc Natl Sci Counc Repub China B. 1998 Oct;22(4):166-72. [PubMed:9850599 ]