You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01045
Secondary Accession Numbers
  • 6334
Name Uridine 5'-monophosphate synthase
Synonyms
  1. OMPdecase
  2. OPRTase
  3. Orotate phosphoribosyltransferase
  4. Orotidine 5'-phosphate decarboxylase
  5. UMP synthase
Gene Name UMPS
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways
  • Drug metabolism - other enzymes
  • Pyrimidine metabolism
  • UMP biosynthesis via de novo pathway
Reactions
Orotidylic acid + Pyrophosphate → Orotic acid + Phosphoribosyl pyrophosphate details
Orotidylic acid → Uridine 5'-monophosphate + CO(2) details
Orotidylic acid → Uridine 5'-monophosphate + Carbon dioxide details
Fluorouracil + Phosphoribosyl pyrophosphate → 5-Fluorouridine monophosphate + Pyrophosphate details
GO Classification
Biological Process
pyrimidine nucleobase metabolic process
UMP biosynthetic process
'de novo' pyrimidine nucleobase biosynthetic process
'de novo' UMP biosynthetic process
Cellular Component
cytosol
nucleus
Function
catalytic activity
transferase activity
lyase activity
carbon-carbon lyase activity
transferase activity, transferring pentosyl groups
carboxy-lyase activity
orotate phosphoribosyltransferase activity
orotidine-5'-phosphate decarboxylase activity
transferase activity, transferring glycosyl groups
Molecular Function
orotate phosphoribosyltransferase activity
orotidine-5'-phosphate decarboxylase activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
cellular aromatic compound metabolic process
nucleoside metabolic process
cellular metabolic process
nucleobase metabolic process
pyrimidine base metabolic process
pyrimidine base biosynthetic process
'de novo' pyrimidine base biosynthetic process
pyrimidine nucleoside monophosphate biosynthetic process
pyrimidine ribonucleoside monophosphate biosynthetic process
'de novo' ump biosynthetic process
ump biosynthetic process
pyrimidine nucleotide metabolic process
pyrimidine nucleotide biosynthetic process
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3q13
SNPs UMPS
Gene Sequence
>1443 bp
ATGGCGGTCGCTCGTGCAGCTTTGGGGCCATTGGTGACGGGTCTGTACGACGTGCAGGCT
TTCAAGTTTGGGGACTTCGTGCTGAAGAGCGGGCTTTCCTCCCCCATCTACATCGATCTG
CGGGGCATCGTGTCTCGACCGCGTCTTCTGAGTCAGGTTGCAGATATTTTATTCCAAACT
GCCCAAAATGCAGGCATCAGTTTTGACACCGTGTGTGGAGTGCCTTATACAGCTTTGCCA
TTGGCTACAGTTATCTGTTCAACCAATCAAATTCCAATGCTTATTAGAAGGAAAGAAACA
AAGGATTATGGAACTAAGCGTCTTGTAGAAGGAACTATTAATCCAGGAGAAACCTGTTTA
ATCATTGAAGATGTTGTCACCAGTGGATCTAGTGTTTTGGAAACTGTTGAGGTTCTTCAG
AAGGAGGGCTTGAAGGTCACTGATGCCATAGTGCTGTTGGACAGAGAGCAGGGAGGCAAG
GACAAGTTGCAGGCGCACGGGATCCGCCTCCACTCAGTGTGTACATTGTCCAAAATGCTG
GAGATTCTCGAGCAGCAGAAAAAAGTTGATGCTGAGACAGTTGGGAGAGTGAAGAGGTTT
ATTCAGGAGAATGTCTTTGTGGCAGCGAATCATAATGGTTCTCCCCTTTCTATAAAGGAA
GCACCCAAAGAACTCAGCTTCGGTGCACGTGCAGAGCTGCCCAGGATCCACCCAGTTGCA
TCGAAGCTTCTCAGGCTTATGCAAAAGAAGGAGACCAATCTGTGTCTATCTGCTGATGTT
TCACTGGCCAGAGAGCTGTTGCAGCTAGCAGATGCTTTAGGACCTAGTATCTGCATGCTG
AAGACTCATGTAGATATTTTGAATGATTTTACTCTGGATGTGATGAAGGAGTTGATAACT
CTGGCAAAATGCCATGAGTTCTTGATATTTGAAGACCGGAAGTTTGCAGATATAGGAAAC
ACAGTGAAAAAGCAGTATGAAGGAGGTATCTTTAAAATAGCTTCCTGGGCAGATCTAGTA
AATGCTCACGTGGTGCCAGGCTCAGGAGTTGTGAAAGGCCTGCAAGAAGTGGGCCTGCCT
TTGCATCGGGGGTGCCTCCTTATTGCGGAAATGAGCTCCACCGGCTCCCTGGCCACTGGG
GACTACACTAGAGCAGCGGTTAGAATGGCTGAGGAGCACTCTGAATTTGTTGTTGGTTTT
ATTTCTGGCTCCCGAGTAAGCATGAAACCAGAATTTCTTCACTTGACTCCAGGAGTTCAG
TTGGAAGCAGGAGGAGATAATCTTGGCCAACAGTACAATAGCCCACAAGAAGTTATTGGC
AAACGAGGTTCCGATATCATCATTGTAGGTCGTGGCATAATCTCAGCAGCTGATCGTCTG
GAAGCAGCAGAGATGTACAGAAAAGCTGCTTGGGAAGCGTATTTGAGTAGACTTGGTGTT
TGA
Protein Properties
Number of Residues 480
Molecular Weight 52221.075
Theoretical pI 7.237
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Uridine 5'-monophosphate synthase
MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
GenBank ID Protein 340168
UniProtKB/Swiss-Prot ID P11172
UniProtKB/Swiss-Prot Entry Name PYR5_HUMAN
PDB IDs
GenBank Gene ID J03626
GeneCard ID UMPS
GenAtlas ID UMPS
HGNC ID HGNC:12563
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Suttle DP, Bugg BY, Winkler JK, Kanalas JJ: Molecular cloning and nucleotide sequence for the complete coding region of human UMP synthase. Proc Natl Acad Sci U S A. 1988 Mar;85(6):1754-8. [PubMed:3279416 ]
  8. Suchi M, Harada N, Tsuboi T, Asai K, Okajima K, Wada Y, Takagi Y: Molecular cloning of human UMP synthase. Adv Exp Med Biol. 1989;253A:511-8. [PubMed:2624233 ]
  9. Suchi M, Mizuno H, Kawai Y, Tsuboi T, Sumi S, Okajima K, Hodgson ME, Ogawa H, Wada Y: Molecular cloning of the human UMP synthase gene and characterization of point mutations in two hereditary orotic aciduria families. Am J Hum Genet. 1997 Mar;60(3):525-39. [PubMed:9042911 ]
  10. Wittmann JG, Heinrich D, Gasow K, Frey A, Diederichsen U, Rudolph MG: Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design. Structure. 2008 Jan;16(1):82-92. doi: 10.1016/j.str.2007.10.020. [PubMed:18184586 ]