You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01112
Secondary Accession Numbers
  • 6405
  • HMDBP06164
Name Monocarboxylate transporter 8
Synonyms
  1. MCT 7
  2. MCT 8
  3. Monocarboxylate transporter 7
  4. Solute carrier family 16 member 2
  5. X-linked PEST-containing transporter
Gene Name SLC16A2
Protein Type Transporter
Biological Properties
General Function Involved in transmembrane transport
Specific Function Very active and specific thyroid hormone transporter. Stimulates cellular uptake of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine. Does not transport Leu, Phe, Trp or Tyr
Pathways Not Available
Reactions Not Available
GO Classification
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SLC16A2
Gene Sequence
>1620 bp
ATGGCGCTGCAAAGCCAGGCGAGCGAGGAAGCAAAGGGGCCCTGGCAGGAGGCAGACCAG
GAACAGCAGGAGCCGGTGGGTAGCCCAGAGCCGGAGTCTGAGCCGGAGCCTGAGCCCGAG
CCCGAGCCCGTGCCAGTGCCCCCGCCCGAGCCCCAGCCGGAGCCCCAGCCCCTACCGGAC
CCCGCACCCCTGCCGGAGCTGGAGTTCGAGTCCGAGCGGGTGCACGAACCCGAGCCCACG
CCTACGGTAGAGACCCGCGGCACCGCGCGCGGCTTCCAGCCTCCCGAAGGTGGCTTCGGC
TGGGTGGTGGTGTTCGCTGCCACCTGGTGCAACGGCTCCATCTTCGGCATCCATAACTCT
GTCGGGATCCTCTACTCCATGCTGCTAGAGGAGGAAAAGGAAAAAAATCGCCAAGTGGAG
TTCCAAGCAGCATGGGTCGGAGCCCTCGCGATGGGTATGATCTTCTTCTGTTCTCCCATT
GTGAGTATATTCACTGACCGTTTGGGCTGCCGAATCACAGCAACCGCGGGGGCTGCCGTT
GCTTTCATTGGCCTCCATACCAGCTCCTTCACCAGCTCCCTAAGCCTGCGCTACTTCACC
TACGGGATTCTCTTTGGTTGTGGCTGTTCCTTCGCCTTTCAGCCATCCCTCGTCATCCTG
GGCCACTACTTTCAACGCCGCCTGGGTCTGGCCAATGGTGTGGTGTCTGCTGGGAGTAGC
ATTTTCTCCATGTCCTTCCCCTTCCTCATCAGAATGCTGGGGGATAAGATCAAGCTGGCC
CAAACCTTCCAGGTGCTGAGTACCTTCATGTTTGTTCTTATGCTGCTTTCACTCACCTAC
CGGCCCCTCCTGCCCAGCTCCCAGGACACCCCAAGCAAGAGAGGTGTCCGCACCCTGCAC
CAGCGCTTTCTGGCTCAGCTCAGGAAGTACTTCAACATGCGAGTGTTCCGCCAACGCACT
TACCGCATCTGGGCCTTCGGAATTGCTGCTGCTGCCCTTGGCTACTTTGTTCCCTATGTA
CACCTGATGAAGTATGTGGAGGAGGAGTTCTCAGAAATCAAGGAGACCTGGGTGCTCTTG
GTGTGTATTGGGGCTACCTCAGGCCTTGGGCGTCTTGTGTCAGGCCACATCAGTGACTCC
ATCCCTGGACTTAAGAAGATCTACTTGCAGGTCCTTTCCTTCCTGCTCCTGGGCCTGATG
TCCATGATGATTCCCCTGTGCCGGGACTTCGGGGGCCTTATTGTCGTCTGTCTTTTCCTG
GGCCTTTGCGATGGCTTCTTCATCACCATCATGGCCCCCATTGCATTTGAGCTGGTGGGC
CCAATGCAGGCCTCACAGGCCATTGGCTACCTCCTGGGCATGATGGCCCTGCCAATGATT
GCTGGGCCCCCCATTGCAGGCCTACTCCGCAACTGTTTTGGGGACTACCATGTGGCCTTC
TACTTTGCCGGTGTGCCCCCCATCATCGGGGCTGTAATCCTCTTCTTCGTCCCTCTGATG
CATCAAAGGATGTTCAAGAAAGAGCAGAGAGATTCCAGCAAGGATAAGATGTTGGCCCCT
GACCCAGACCCCAATGGGGAGCTACTGCCGGGCTCCCCCAACCCTGAGGAACCAATCTAA
Protein Properties
Number of Residues 539
Molecular Weight 59510.9
Theoretical pI 5.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 97-117
  • 144-164
  • 172-192
  • 201-221
  • 230-250
  • 259-279
  • 323-343
  • 357-377
  • 387-407
  • 410-430
  • 448-468
  • 478-498
Protein Sequence
>Monocarboxylate transporter 8
MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPD
PAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNS
VGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAV
AFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSS
IFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLH
QRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLL
VCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFL
GLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAF
YFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
GenBank ID Protein 31076331
UniProtKB/Swiss-Prot ID P36021
UniProtKB/Swiss-Prot Entry Name MOT8_HUMAN
PDB IDs Not Available
GenBank Gene ID AB085789
GeneCard ID SLC16A2
GenAtlas ID SLC16A2
HGNC ID HGNC:10923
References
General References
  1. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  4. Lafreniere RG, Carrel L, Willard HF: A novel transmembrane transporter encoded by the XPCT gene in Xq13.2. Hum Mol Genet. 1994 Jul;3(7):1133-9. [PubMed:7981683 ]
  5. Dumitrescu AM, Liao XH, Best TB, Brockmann K, Refetoff S: A novel syndrome combining thyroid and neurological abnormalities is associated with mutations in a monocarboxylate transporter gene. Am J Hum Genet. 2004 Jan;74(1):168-75. Epub 2003 Dec 5. [PubMed:14661163 ]
  6. Frints SG, Lenzner S, Bauters M, Jensen LR, Van Esch H, des Portes V, Moog U, Macville MV, van Roozendaal K, Schrander-Stumpel CT, Tzschach A, Marynen P, Fryns JP, Hamel B, van Bokhoven H, Chelly J, Beldjord C, Turner G, Gecz J, Moraine C, Raynaud M, Ropers HH, Froyen G, Kuss AW: MCT8 mutation analysis and identification of the first female with Allan-Herndon-Dudley syndrome due to loss of MCT8 expression. Eur J Hum Genet. 2008 Sep;16(9):1029-37. doi: 10.1038/ejhg.2008.66. Epub 2008 Apr 9. [PubMed:18398436 ]
  7. Friesema EC, Grueters A, Biebermann H, Krude H, von Moers A, Reeser M, Barrett TG, Mancilla EE, Svensson J, Kester MH, Kuiper GG, Balkassmi S, Uitterlinden AG, Koehrle J, Rodien P, Halestrap AP, Visser TJ: Association between mutations in a thyroid hormone transporter and severe X-linked psychomotor retardation. Lancet. 2004 Oct 16-22;364(9443):1435-7. [PubMed:15488219 ]
  8. Schwartz CE, May MM, Carpenter NJ, Rogers RC, Martin J, Bialer MG, Ward J, Sanabria J, Marsa S, Lewis JA, Echeverri R, Lubs HA, Voeller K, Simensen RJ, Stevenson RE: Allan-Herndon-Dudley syndrome and the monocarboxylate transporter 8 (MCT8) gene. Am J Hum Genet. 2005 Jul;77(1):41-53. Epub 2005 May 11. [PubMed:15889350 ]
  9. Visser WE, Jansen J, Friesema EC, Kester MH, Mancilla E, Lundgren J, van der Knaap MS, Lunsing RJ, Brouwer OF, Visser TJ: Novel pathogenic mechanism suggested by ex vivo analysis of MCT8 (SLC16A2) mutations. Hum Mutat. 2009 Jan;30(1):29-38. doi: 10.1002/humu.20808. [PubMed:18636565 ]