You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01145
Secondary Accession Numbers
  • 6441
Name Tyrosine-protein kinase TXK
Synonyms
  1. Protein-tyrosine kinase 4
Gene Name TXK
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
protein tyrosine kinase activity
non-membrane spanning protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
signaling process
signal transmission
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
signal transmission via phosphorylation event
intracellular protein kinase cascade
Cellular Location
  1. Cytoplasm (Probable)
Gene Properties
Chromosome Location Chromosome:4
Locus 4p12
SNPs TXK
Gene Sequence
>1584 bp
ATGATCCTTTCCTCCTATAACACCATCCAGTCGGTTTTCTGTTGCTGCTGTTGCTGTTCA
GTGCAGAAGCGACAAATGAGAACACAGATAAGCCTGAGCACAGATGAAGAGCTTCCAGAA
AAATACACCCAGCATCGCAGGCCGTGGCTCAGCCAATTGTCAAATAAGAAGCAATCCAAC
ACGGGCCGTGTGCAGCCGTCAAAACGAAAGCCACTGCCTCCCCTCCCACCCTCTGAGGTT
GCTGAAGAGAAGATCCAAGTCAAGGCACTTTATGATTTTCTGCCCAGAGAACCCTGTAAT
TTAGCCTTAAGGAGAGCAGAAGAATACCTGATACTGGAGAAATACAATCCTCACTGGTGG
AAGGCAAGAGACCGTTTGGGGAATGAAGGCTTAATCCCAAGCAACTATGTGACTGAAAAC
AAAATAACTAATTTAGAAATATATGAGTGGTACCATAGAAACATTACCAGAAATCAGGCA
GAACATCTATTGAGACAAGAGTCTAAAGAAGGTGCATTTATTGTCAGAGATTCAAGACAT
TTAGGATCCTACACAATTTCCGTATTTATGGGAGCTAGAAGAAGTACGGAGGCTGCCATA
AAACATTATCAGATAAAAAAGAATGACTCAGGACAGTGGTATGTGGCTGAAAGACACGCC
TTTCAATCAATCCCTGAGTTAATCTGGTATCACCAGCACAATGCAGCCGGTCTCATGACT
CGTCTCCGATATCCAGTTGGGCTGATGGGCAGTTGTTTACCAGCCACAGCTGGGTTTAGC
TACGAAAAGTGGGAGATAGATCCATCTGAGTTGGCTTTTATAAAGGAGATTGGAAGCGGT
CAGTTTGGAGTGGTCCATTTAGGTGAATGGCGGTCACATATCCAGGTAGCTATCAAGGCC
ATCAATGAAGGCTCCATGTCTGAAGAGGATTTCATTGAAGAGGCCAAAGTGATGATGAAA
TTATCTCATTCAAAGCTAGTGCAACTTTATGGAGTCTGTATACAGCGGAAGCCCCTTTAC
ATTGTGACAGAGTTCATGGAAAATGGCTGCCTGCTTAACTATCTCAGGGAGAATAAAGGA
AAGCTTAGGAAGGAAATGCTACTGAGTGTATGCCAGGATATATGTGAAGGAATGGAATAT
CTGGAGAGGAATGGCTATATTCATAGGGATTTGGCGGCAAGGAATTGTTTGGTCAGTTCA
ACATGCATAGTAAAAATTTCAGACTTTGGAATGACAAGGTACGTTTTGGATGATGAGTAT
GTCAGTTCTTTTGGAGCCAAGTTCCCAATCAAGTGGTCCCCTCCTGAAGTTTTTCTTTTC
AATAAGTACAGCAGTAAATCTGATGTCTGGTCATTTGGAGTTTTAATGTGGGAAGTTTTT
ACAGAAGGAAAAATGCCTTTTGAAAATAAGTCAAATTTGCAAGTCGTGGAAGCTATTTCT
GAAGGCTTCAGGCTATATCGCCCTCACCTGGCACCAATGTCCATATATGAAGTCATGTAC
AGCTGCTGGCATGAGAAACCTGAAGGCCGCCCTACATTTGCGGAGCTGCTGCGGGCTGTC
ACAGAGATTGCGGAAACCTGGTGA
Protein Properties
Number of Residues 527
Molecular Weight 61257.9
Theoretical pI 8.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tyrosine-protein kinase TXK
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
GenBank ID Protein 684986
UniProtKB/Swiss-Prot ID P42681
UniProtKB/Swiss-Prot Entry Name TXK_HUMAN
PDB IDs Not Available
GenBank Gene ID L27071
GeneCard ID TXK
GenAtlas ID TXK
HGNC ID HGNC:12434
References
General References
  1. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  2. Haire RN, Ohta Y, Lewis JE, Fu SM, Kroisel P, Litman GW: TXK, a novel human tyrosine kinase expressed in T cells shares sequence identity with Tec family kinases and maps to 4p12. Hum Mol Genet. 1994 Jun;3(6):897-901. [PubMed:7951233 ]
  3. Ohta Y, Haire RN, Amemiya CT, Litman RT, Trager T, Riess O, Litman GW: Human Txk: genomic organization, structure and contiguous physical linkage with the Tec gene. Oncogene. 1996 Feb 15;12(4):937-42. [PubMed:8632917 ]