You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01197
Secondary Accession Numbers
  • 6493
Name Serine/threonine-protein kinase SIK1
Synonyms
  1. SIK-1
  2. Salt-inducible protein kinase 1
  3. Serine/threonine-protein kinase SNF1-like kinase 1
  4. Serine/threonine-protein kinase SNF1LK
Gene Name SIK1
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. Potential role in G2/M cell cycle regulation. Inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
magnesium ion binding
protein binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
signaling process
signal transmission
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
signal transmission via phosphorylation event
intracellular protein kinase cascade
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:2
Locus 21q22.3
SNPs SIK1
Gene Sequence
>2352 bp
ATGGTTATCATGTCGGAGTTCAGCGCGGACCCCGCGGGCCAGGGTCAGGGCCAGCAGAAG
CCCCTCCGGGTGGGTTTTTACGACATCGAGCGGACCCTGGGCAAAGGCAACTTCGCGGTG
GTGAAGCTGGCGCGGCATCGAGTCACCAAAACGCAGGTTGCAATAAAAATAATTGATAAA
ACACGATTAGATTCAAGCAATTTGGAGAAAATCTATCGTGAGGTTCAGCTGATGAAGCTT
CTGAACCATCCACACATCATAAAGCTTTACCAGGTTATGGAAACAAAGGACATGCTTTAC
ATCGTCACTGAATTTGCTAAAAATGGAGAAATGTTTGATTATTTGACTTCCAACGGGCAC
CTGAGTGAGAACGAGGCGCGGAAGAAGTTCTGGCAAATCCTGTCGGCCGTGGAGTACTGT
CACGACCATCACATCGTCCACCGGGACCTCAAGACCGAGAACCTCCTGCTGGATGGCAAC
ATGGACATCAAGCTGGCAGATTTTGGATTTGGGAATTTCTACAAGTCAGGAGAGCCTCTG
TCCACGTGGTGTGGGAGCCCCCCGTATGCCGCCCCGGAAGTCTTTGAGGGGAAGGAGTAT
GAAGGCCCCCAGCTGGACATCTGGAGCCTGGGCGTGGTGCTGTACGTCCTGGTCTGCGGT
TCTCTCCCCTTCGATGGGCCTAACCTGCCGACGCTGAGACAGCGGGTGCTGGAGGGCCGC
TTCCGCATCCCCTTCTTCATGTCTCAAGACTGTGAGAGCCTGATCCGCCGCATGCTGGTG
GTGGACCCCGCCAGGCGCATCACCATCGCCCAGATCCGGCAGCACCGGTGGATGCGGGCT
GAGCCCTGCTTGCCGGGACCCGCCTGCCCCGCCTTCTCCGCACACAGCTACACCTCCAAC
CTGGGCGACTACGATGAGCAGGCGCTGGGTATCATGCAGACCCTGGGCGTGGACCGGCAG
AGGACGGTGGAGTCACTGCAAAACAGCAGCTATAACCACTTTGCTGCCATTTATTACCTC
CTCCTTGAGCGGCTCAAGGAGTATCGGAATGCCCAGTGCGCCCGCCCCGGGCCTGCCAGG
CAGCCGCGGCCTCGGAGCTCGGACCTCAGTGGTTTGGAGGTGCCTCAGGAAGGTCTTTCC
ACCGACCCTTTCCGACCTGCCTTGCTGTGCCCGCAGCCGCAGACCTTGGTGCAGTCCGTC
CTCCAGGCCGAGATGGACTGTGAGCTCCAGAGCTCGCTGCAGTGGCCCTTGTTCTTCCCG
GTGGATGCCAGCTGCAGCGGAGTGTTCCGGCCCCGGCCCGTGTCCCCAAGCAGCCTGCTG
GACACAGCCATCAGTGAGGAGGCCAGGCAGGGGCCGGGCCTAGAGGAGGAGCAGGACACG
CAGGAGTCCCTGCCCAGCAGCACGGGCCGGAGGCACACCCTGGCCGAGGTCTCCACCCGC
CTCTCCCCACTCACCGCGCCATGTATAGTCGTCTCCCCCTCCACCACGGCAAGTCCTGCA
GAGGGAACCAGCTCTGACAGTTGTCTGACCTTCTCTGCGAGCAAAAGCCCCGCGGGGCTC
AGTGGCACCCCGGCCACTCAGGGGCTGCTGGGCGCCTGCTCCCCGGTCAGGCTGGCCTCG
CCCTTCCTGGGGTCGCAGTCCGCCACCCCAGTGCTGCAGGCTCAGGGGGGCTTGGGAGGA
GCTGTTCTGCTCCCTGTCAGCTTCCAGGAGGGACGGCGGGCGTCGGACACCTCACTGACT
CAAGGGCTGAAGGCCTTTCGGCAGCAGCTGAGGAAGACCACGCGGACCAAAGGGTTTCTG
GGACTGAACAAAATCAAGGGGCTGGCTCGCCAGGTGTGCCAGGCCCCCGCCAGCCGGGCC
AGCAGGGGCGGCCTGAGCCCCTTCCACGCCCCTGCACAGAGCCCAGGCCTGCACGGCGGC
GCAGCCGGCAGCCGGGAGGGCTGGAGCCTGCTGGAGGAGGTGCTAGAGCAGCAGAGGCTG
CTCCAGTTACAGCACCACCCGGCCGCTGCACCCGGCTGCTCCCAGGCCCCCCAGCCGGCC
CCTGCCCCGTTTGTGATCGCCCCCTGTGATGGCCCTGGGGCTGCCCCGCTCCCCAGCACC
CTCCTCACGTCGGGGCTCCCGCTGCTGCCGCCCCCACTCCTGCAGACCGGCGCGTCCCCG
GTGGCCTCAGCGGCGCAGCTCCTGGACACACACCTGCACATTGGCACCGGCCCCACCGCC
CTCCCCGCTGTGCCCCCACCACGCCTGGCCAGGCTGGCCCCAGGTTGTGAGCCCCTGGGG
CTGCTGCAGGGGGACTGTGAGATGGAGGACCTGATGCCCTGCTCCCTAGGCACGTTTGTC
CTGGTGCAGTGA
Protein Properties
Number of Residues 783
Molecular Weight 84901.3
Theoretical pI 7.21
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase SIK1
MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDK
TRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGH
LSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSGEPL
STWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGR
FRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRAEPCLPGPACPAFSAHSYTSN
LGDYDEQALGIMQTLGVDRQRTVESLQNSSYNHFAAIYYLLLERLKEYRNAQCARPGPAR
QPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFP
VDASCSGVFRPRPVSPSSLLDTAISEEARQGPGLEEEQDTQESLPSSTGRRHTLAEVSTR
LSPLTAPCIVVSPSTTASPAEGTSSDSCLTFSASKSPAGLSGTPATQGLLGACSPVRLAS
PFLGSQSATPVLQAQGGLGGAVLLPVSFQEGRRASDTSLTQGLKAFRQQLRKTTRTKGFL
GLNKIKGLARQVCQAPASRASRGGLSPFHAPAQSPGLHGGAAGSREGWSLLEEVLEQQRL
LQLQHHPAAAPGCSQAPQPAPAPFVIAPCDGPGAAPLPSTLLTSGLPLLPPPLLQTGASP
VASAAQLLDTHLHIGTGPTALPAVPPPRLARLAPGCEPLGLLQGDCEMEDLMPCSLGTFV
LVQ
GenBank ID Protein 56377677
UniProtKB/Swiss-Prot ID P57059
UniProtKB/Swiss-Prot Entry Name SIK1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB047786
GeneCard ID SIK1
GenAtlas ID SIK1
HGNC ID HGNC:11142
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  5. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [PubMed:10830953 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Lizcano JM, Goransson O, Toth R, Deak M, Morrice NA, Boudeau J, Hawley SA, Udd L, Makela TP, Hardie DG, Alessi DR: LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1. EMBO J. 2004 Feb 25;23(4):833-43. Epub 2004 Feb 19. [PubMed:14976552 ]
  8. Al-Hakim AK, Goransson O, Deak M, Toth R, Campbell DG, Morrice NA, Prescott AR, Alessi DR: 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK. J Cell Sci. 2005 Dec 1;118(Pt 23):5661-73. [PubMed:16306228 ]