You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01293
Secondary Accession Numbers
  • 6589
Name Cell division protein kinase 12
Synonyms
  1. CDC2-related protein kinase 7
  2. Cdc2-related kinase, arginine/serine-rich
  3. Cell division cycle 2-related protein kinase 7
  4. CrkRS
Gene Name CDK12
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Involved in RNA splicing
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Nucleus speckle
Gene Properties
Chromosome Location Chromosome:1
Locus 17q12
SNPs CDK12
Gene Sequence
>4473 bp
ATGCCCAATTCAGAGAGACATGGGGGCAAGAAGGACGGGAGTGGAGGAGCTTCTGGAACT
TTGCAGCCGTCATCGGGAGGCGGCAGCTCTAACAGCAGAGAGCGTCACCGCTTGGTATCG
AAGCACAAGCGGCATAAGTCCAAACACTCCAAAGACATGGGGTTGGTGACCCCCGAAGCA
GCATCCCTGGGCACAGTTATCAAACCTTTGGTGGAGTATGATGATATCAGCTCTGATTCC
GACACCTTCTCCGATGACATGGCCTTCAAACTAGACCGAAGGGAGAACGACGAACGTCGT
GGATCAGATCGGAGCGACCGCCTGCACAAACATCGTCACCACCAGCACAGGCGTTCCCGG
GACTTACTAAAAGCTAAACAGACCGAAAAAGAAAAAAGCCAAGAAGTCTCCAGCAAGTCG
GGATCGATGAAGGACCGGATATCGGGAAGTTCAAAGCGTTCGAATGAGGAGACTGATGAC
TATGGGAAGGCGCAGGTAGCCAAAAGCAGCAGCAAGGAATCCAGGTCATCCAAGCTCCAC
AAGGAGAAGACCAGGAAAGAACGGGAGCTGAAGTCTGGGCACAAAGACCGGAGTAAAAGT
CATCGAAAAAGGGAAACACCCAAAAGTTACAAAACAGTGGACAGCCCAAAACGGAGATCC
AGGAGCCCCCACAGGAAGTGGTCTGACAGCTCCAAACAAGATGATAGCCCCTCGGGAGCT
TCTTATGGCCAAGATTATGACCTTAGTCCCTCACGATCTCATACCTCGAGCAATTATGAC
TCCTACAAGAAAAGTCCTGGAAGTACCTCGAGAAGGCAGTCGGTCAGTCCCCCTTACAAG
GAGCCTTCGGCCTACCAGTCCAGCACCCGGTCACCGAGCCCCTACAGTAGGCGACAGAGA
TCTGTCAGTCCCTATAGCAGGAGACGGTCGTCCAGCTACGAAAGAAGTGGCTCTTACAGC
GGGCGATCGCCCAGTCCCTATGGTCGAAGGCGGTCCAGCAGCCCTTTCCTGAGCAAGCGG
TCTCTGAGTCGGAGTCCACTCCCCAGTAGGAAATCCATGAAGTCCAGAAGTAGAAGTCCT
GCATATTCAAGACATTCATCTTCTCATAGTAAAAAGAAGAGATCCAGTTCACGCAGTCGT
CATTCCAGTATCTCACCTGTCAGGCTTCCACTTAATTCCAGTCTGGGAGCTGAACTCAGT
AGGAAAAAGAAGGAAAGAGCAGCTGCTGCTGCTGCAGCAAAGATGGATGGAAAGGAGTCC
AAGGGTTCACCTGTATTTTTGCCTAGAAAAGAGAACAGTTCAGTAGAGGCTAAGGATTCA
GGTTTGGAGTCTAAAAAGTTACCCAGAAGTGTAAAATTGGAAAAATCTGCCCCAGATACT
GAACTGGTGAATGTAACACATCTAAACACAGAGGTAAAAAATTCTTCAGATACAGGGAAA
GTAAAGTTGGATGAGAACTCCGAGAAGCATCTTGTTAAAGATTTGAAAGCACAGGGAACA
AGAGACTCTAAACCCATAGCACTGAAAGAGGAGATTGTTACTCCAAAGGAGACAGAAACA
TCAGAAAAGGAGACCCCTCCACCTCTTCCCACAATTGCTTCTCCCCCACCCCCTCTACCA
ACTACTACCCCTCCACCTCAGACACCCCCTTTGCCACCTTTGCCTCCAATACCAGCTCTT
CCACAGCAACCACCTCTGCCTCCTTCTCAGCCAGCATTTAGTCAGGTTCCTGCTTCCAGT
ACTTCAACTTTGCCCCCTTCTACTCACTCAAAGACATCTGCTGTGTCCTCTCAGGCAAAT
TCTCAGCCCCCTGTACAGGTTTCTGTGAAGACTCAAGTATCTGTAACAGCTGCTATTCCA
CACCTGAAAACTTCAACGTTGCCTCCTTTGCCCCTCCCACCCTTATTACCTGGAGATGAT
GACATGGATAGTCCAAAAGAAACTCTTCCTTCAAAACCTGTGAAGAAAGAGAAGGAACAG
AGGACACGTCACTTACTCACAGACCTTCCTCTCCCTCCAGAGCTCCCTGGTGGAGATCTG
TCTCCCCCAGACTCTCCAGAACCAAAGGCAATCACACCACCTCAGCAACCATATAAAAAG
AGACCAAAAATTTGTTGTCCTCGTTATGGAGAAAGAAGACAAACAGAAAGCGACTGGGGG
AAACGCTGTGTGGACAAGTTTGACATTATTGGGATTATTGGAGAAGGAACCTATGGCCAA
GTATATAAAGCCAAGGACAAAGACACAGGAGAACTAGTGGCTCTGAAGAAGGTGAGACTA
GACAATGAGAAAGAGGGCTTCCCAATCACAGCCATTCGTGAAATCAAAATCCTTCGTCAG
TTAATCCACCGAAGTGTTGTTAACATGAAGGAAATTGTCACAGATAAACAAGATGCACTG
GATTTCAAGAAGGACAAAGGTGCCTTTTACCTTGTATTTGAGTATATGGACCATGACTTA
ATGGGACTGCTAGAATCTGGTTTGGTGCACTTTTCTGAGGACCATATCAAGTCGTTCATG
AAACAGCTAATGGAAGGATTGGAATACTGTCACAAAAAGAATTTCCTGCATCGGGATATT
AAGTGTTCTAACATTTTGCTGAATAACAGTGGGCAAATCAAACTAGCAGATTTTGGACTT
GCTCGGCTCTATAACTCTGAAGAGAGTCGCCCTTACACAAACAAAGTCATTACTTTGTGG
TACCGACCTCCAGAACTACTGCTAGGAGAGGAACGTTACACACCAGCCATAGATGTTTGG
AGCTGTGGATGTATTCTTGGGGAACTATTCACAAAGAAGCCTATTTTTCAAGCCAATCTG
GAACTGGCTCAGCTAGAACTGATCAGCCGACTTTGTGGTAGCCCTTGTCCAGCTGTGTGG
CCTGATGTTATCAAACTGCCCTACTTCAACACCATGAAACCGAAGAAGCAATATCGAAGG
CGTCTACGAGAAGAATTCTCTTTCATTCCTTCTGCAGCACTTGATTTATTGGACCACATG
CTGACACTAGATCCTAGTAAGCGGTGCACAGCTGAACAGACCCTACAGAGCGACTTCCTT
AAAGATGTCGAACTCAGCAAAATGGCTCCTCCAGACCTCCCCCACTGGCAGGATTGCCAT
GAGTTGTGGAGTAAGAAACGGCGACGTCAGCGACAAAGTGGTGTTGTAGTCGAAGAGCCA
CCTCCATCCAAAACTTCTCGAAAAGAAACTACCTCAGGGACAAGTACTGAGCCTGTGAAG
AACAGCAGCCCAGCACCACCTCAGCCTGCTCCTGGCAAGGTGGAGTCTGGGGCTGGGGAT
GCAATAGGCCTTGCTGACATCACACAACAGCTGAATCAAAGTGAATTGGCAGTGTTATTA
AACCTGCTGCAGAGCCAAACCGACCTGAGCATCCCTCAAATGGCACAGCTGCTTAACATC
CACTCCAACCCAGAGATGCAGCAGCAGCTGGAAGCCCTGAACCAATCCATCAGTGCCCTG
ACGGAAGCTACTTCCCAGCAGCAGGACTCAGAGACCATGGCCCCAGAGGAGTCTTTGAAG
GAAGCACCCTCTGCCCCAGTGATCCTGCCTTCAGCAGAACAGACGACCCTTGAAGCTTCA
AGCACACCAGCTGACATGCAGAATATATTGGCAGTTCTCTTGAGTCAGCTGATGAAAACC
CAAGAGCCAGCAGGCAGTCTGGAGGAAAACAACAGTGACAAGAACAGTGGGCCACAGGGG
CCCCGAAGAACTCCCACAATGCCACAGGAGGAGGCAGCAGCATGTCCTCCTCACATTCTT
CCACCAGAGAAGAGGCCCCCTGAGCCCCCCGGACCTCCACCGCCGCCACCTCCACCCCCT
CTGGTTGAAGGCGATCTTTCCAGCGCCCCCCAGGAGTTGAACCCAGCCGTGACAGCCGCC
TTGCTGCAACTTTTATCCCAGCCTGAAGCAGAGCCTCCTGGCCACCTGCCACATGAGCAC
CAGGCCTTGAGACCAATGGAGTACTCCACCCGACCCCGTCCAAACAGGACTTATGGAAAC
ACTGATGGGCCTGAAACAGGGTTCAGTGCCATTGACACTGATGAACGAAACTCTGGTCCA
GCCTTGACAGAATCCTTGGTCCAGACCCTGGTGAAGAACAGGACCTTCTCAGGCTCTCTG
AGCCACCTTGGGGAGTCCAGCAGTTACCAGGGCACAGGGTCAGTGCAGTTTCCAGGGGAC
CAGGACCTCCGTTTTGCCAGGGTCCCCTTAGCGTTACACCCGGTGGTCGGGCAACCATTC
CTGAAGGCTGAGGGAAGCAGCAATTCTGTGGTACATGCAGAGACCAAATTGCAAAACTAT
GGGGAGCTGGGGCCAGGAACCACTGGGGCCAGCAGCTCAGGAGCAGGCCTTCACTGGGGG
GGCCCAACTCAGTCTTCTGCTTATGGAAAACTCTATCGGGGGCCTACAAGAGTCCCACCA
AGAGGGGGAAGAGGGAGAGGAGTTCCTTACTAA
Protein Properties
Number of Residues 1490
Molecular Weight 164153.0
Theoretical pI 10.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cell division protein kinase 12
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEA
ASLGTVIKPLVEYDDISSDSDTFSDDMAFKLDRRENDERRGSDRSDRLHKHRHHQHRRSR
DLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDYGKAQVAKSSSKESRSSKLH
KEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGA
SYGQDYDLSPSRSHTSSNYDSYKKSPGSTSRRQSVSPPYKEPSAYQSSTRSPSPYSRRQR
SVSPYSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP
AYSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKES
KGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPDTELVNVTHLNTEVKNSSDTGK
VKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLP
TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQAN
SQPPVQVSVKTQVSVTAAIPHLKTSTLPPLPLPPLLPGDDDMDSPKETLPSKPVKKEKEQ
RTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKKRPKICCPRYGERRQTESDWG
KRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQ
LIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFM
KQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLW
YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVW
PDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL
KDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK
NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNI
HSNPEMQQQLEALNQSISALTEATSQQQDSETMAPEESLKEAPSAPVILPSAEQTTLEAS
STPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAACPPHIL
PPEKRPPEPPGPPPPPPPPPLVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEH
QALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
SHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNY
GELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY
GenBank ID Protein 157817023
UniProtKB/Swiss-Prot ID Q9NYV4
UniProtKB/Swiss-Prot Entry Name CDK12_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_016507.2
GeneCard ID CDK12
GenAtlas ID CDK12
HGNC ID HGNC:24224
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  7. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  8. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  11. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  12. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  13. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  14. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  15. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]
  16. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  17. Ko TK, Kelly E, Pines J: CrkRS: a novel conserved Cdc2-related protein kinase that colocalises with SC35 speckles. J Cell Sci. 2001 Jul;114(Pt 14):2591-603. [PubMed:11683387 ]