You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01538
Secondary Accession Numbers
  • 6834
Name LIM domain kinase 1
Synonyms
  1. LIMK-1
Gene Name LIMK1
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function Protein kinase which regulates actin filament dynamics. Phosphorylates and inactivates the actin binding/depolymerizing factor cofilin, thereby stabilizing the actin cytoskeleton. Stimulates axonal outgrowth and may be involved in brain development. Isoform 3 has a dominant negative effect on actin cytoskeletal changes
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
  2. Cell projection
  3. growth cone
Gene Properties
Chromosome Location Chromosome:7
Locus 7q11.23
SNPs LIMK1
Gene Sequence
>1944 bp
ATGAGGTTGACGCTACTTTGTTGCACCTGGAGGGAAGAACGTATGGGAGAGGAAGGAAGC
GAGTTGCCCGTGTGTGCAAGCTGCGGCCAGAGGATCTATGATGGCCAGTACCTCCAGGCC
CTGAACGCGGACTGGCACGCAGACTGCTTCAGGTGTTGTGACTGCAGTGCCTCCCTGTCG
CACCAGTACTATGAGAAGGATGGGCAGCTCTTCTGCAAGAAGGACTACTGGGCCCGCTAT
GGCGAGTCCTGCCATGGGTGCTCTGAGCAAATCACCAAGGGACTGGTTATGGTGGCTGGG
GAGCTGAAGTACCACCCCGAGTGTTTCATCTGCCTCACGTGTGGGACCTTTATCGGTGAC
GGGGACACCTACACGCTGGTGGAGCACTCCAAGCTGTACTGCGGGCACTGCTACTACCAG
ACTGTGGTGACCCCCGTCATCGAGCAGATCCTGCCTGACTCCCCTGGCTCCCACCTGCCC
CACACCGTCACCCTGGTGTCCATCCCAGCCTCATCTCATGGCAAGCGTGGACTTTCAGTC
TCCATTGACCCCCCGCACGGCCCACCGGGCTGTGGCACCGAGCACTCACACACCGTCCGC
GTCCAGGGAGTGGATCCGGGCTGCATGAGCCCAGATGTGAAGAATTCCATCCACGTCGGA
GACCGGATCTTGGAAATCAATGGCACGCCCATCCGAAATGTGCCCCTGGACGAGATTGAC
CTGCTGATTCAGGAAACCAGCCGCCTGCTCCAGCTGACCCTCGAGCATGACCCTCACGAT
ACACTGGGCCACGGGCTGGGGCCTGAGACCAGCCCCCTGAGCTCTCCGGCTTATACTCCC
AGCGGGGAGGCGGGCAGCTCTGCCCGGCAGAAACCTGTCTTGAGGAGCTGCAGCATCGAC
AGGTCTCCGGGCGCTGGCTCACTGGGCTCCCCGGCCTCCCAGCGCAAGGACCTGGGTCGC
TCTGAGTCCCTCCGCGTAGTCTGCCGGCCACACCGCATCTTCCGGCCGTCGGACCTCATC
CACGGGGAGGTGCTGGGCAAGGGCTGCTTCGGCCAGGCTATCAAGGTGACACACCGTGAG
ACAGGTGAGGTGATGGTGATGAAGGAGCTGATCCGGTTCGACGAGGAGACCCAGAGGACG
TTCCTCAAGGAGGTGAAGGTCATGCGATGCCTGGAACACCCCAACGTGCTCAAGTTCATC
GGGGTGCTCTACAAGGACAAGAGGCTCAACTTCATCACTGAGTACATCAAGGGCGGCACG
CTCCGGGGCATCATCAAGAGCATGGACAGCCAGTACCCATGGAGCCAGAGAGTGAGCTTT
GCCAAGGACATCGCATCAGGGATGGCCTACCTCCACTCCATGAACATCATCCACCGAGAC
CTCAACTCCCACAACTGCCTGGTCCGCGAGAACAAGAATGTGGTGGTGGCTGACTTCGGG
CTGGCGCGTCTCATGGTGGACGAGAAGACTCAGCCTGAGGGCCTGCGGAGCCTCAAGAAG
CCAGACCGCAAGAAGCGCTACACCGTGGTGGGCAACCCCTACTGGATGGCACCTGAGATG
ATCAACGGCCGCAGCTATGATGAGAAGGTGGATGTGTTCTCCTTTGGGATCGTCCTGTGC
GAGATCATCGGGCGGGTGAACGCAGACCCTGACTACCTGCCCCGCACCATGGACTTTGGC
CTCAACGTGCGAGGATTCCTGGACCGCTACTGCCCCCCAAACTGCCCCCCGAGCTTCTTC
CCCATCACCGTGCGCTGTTGCGATCTGGACCCCGAGAAGAGGCCATCCTTTGTGAAGCTG
GAACACTGGCTGGAGACCCTCCGCATGCACCTGGCCGGCCACCTGCCACTGGGCCCACAG
CTGGAGCAGCTGGACAGAGGTTTCTGGGAGACCTACCGGCGCGGCGAGAGCGGACTGCCT
GCCCACCCTGAGGTCCCCGACTGA
Protein Properties
Number of Residues 647
Molecular Weight 72584.4
Theoretical pI 6.98
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>LIM domain kinase 1
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
GenBank ID Protein 4505001
UniProtKB/Swiss-Prot ID P53667
UniProtKB/Swiss-Prot Entry Name LIMK1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002314.2
GeneCard ID LIMK1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  6. Hillman RT, Green RE, Brenner SE: An unappreciated role for RNA surveillance. Genome Biol. 2004;5(2):R8. Epub 2004 Feb 2. [PubMed:14759258 ]
  7. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  8. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  9. Soosairajah J, Maiti S, Wiggan O, Sarmiere P, Moussi N, Sarcevic B, Sampath R, Bamburg JR, Bernard O: Interplay between components of a novel LIM kinase-slingshot phosphatase complex regulates cofilin. EMBO J. 2005 Feb 9;24(3):473-86. Epub 2005 Jan 20. [PubMed:15660133 ]
  10. Maekawa M, Ishizaki T, Boku S, Watanabe N, Fujita A, Iwamatsu A, Obinata T, Ohashi K, Mizuno K, Narumiya S: Signaling from Rho to the actin cytoskeleton through protein kinases ROCK and LIM-kinase. Science. 1999 Aug 6;285(5429):895-8. [PubMed:10436159 ]
  11. Mizuno K, Okano I, Ohashi K, Nunoue K, Kuma K, Miyata T, Nakamura T: Identification of a human cDNA encoding a novel protein kinase with two repeats of the LIM/double zinc finger motif. Oncogene. 1994 Jun;9(6):1605-12. [PubMed:8183554 ]
  12. Frangiskakis JM, Ewart AK, Morris CA, Mervis CB, Bertrand J, Robinson BF, Klein BP, Ensing GJ, Everett LA, Green ED, Proschel C, Gutowski NJ, Noble M, Atkinson DL, Odelberg SJ, Keating MT: LIM-kinase1 hemizygosity implicated in impaired visuospatial constructive cognition. Cell. 1996 Jul 12;86(1):59-69. [PubMed:8689688 ]
  13. Osborne LR, Martindale D, Scherer SW, Shi XM, Huizenga J, Heng HH, Costa T, Pober B, Lew L, Brinkman J, Rommens J, Koop B, Tsui LC: Identification of genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients. Genomics. 1996 Sep 1;36(2):328-36. [PubMed:8812460 ]
  14. Edwards DC, Gill GN: Structural features of LIM kinase that control effects on the actin cytoskeleton. J Biol Chem. 1999 Apr 16;274(16):11352-61. [PubMed:10196227 ]
  15. Ohashi K, Nagata K, Maekawa M, Ishizaki T, Narumiya S, Mizuno K: Rho-associated kinase ROCK activates LIM-kinase 1 by phosphorylation at threonine 508 within the activation loop. J Biol Chem. 2000 Feb 4;275(5):3577-82. [PubMed:10652353 ]
  16. Niwa R, Nagata-Ohashi K, Takeichi M, Mizuno K, Uemura T: Control of actin reorganization by Slingshot, a family of phosphatases that dephosphorylate ADF/cofilin. Cell. 2002 Jan 25;108(2):233-46. [PubMed:11832213 ]
  17. Kaji N, Ohashi K, Shuin M, Niwa R, Uemura T, Mizuno K: Cell cycle-associated changes in Slingshot phosphatase activity and roles in cytokinesis in animal cells. J Biol Chem. 2003 Aug 29;278(35):33450-5. Epub 2003 Jun 14. [PubMed:12807904 ]
  18. Nishita M, Tomizawa C, Yamamoto M, Horita Y, Ohashi K, Mizuno K: Spatial and temporal regulation of cofilin activity by LIM kinase and Slingshot is critical for directional cell migration. J Cell Biol. 2005 Oct 24;171(2):349-59. Epub 2005 Oct 17. [PubMed:16230460 ]
  19. Acevedo K, Li R, Soo P, Suryadinata R, Sarcevic B, Valova VA, Graham ME, Robinson PJ, Bernard O: The phosphorylation of p25/TPPP by LIM kinase 1 inhibits its ability to assemble microtubules. Exp Cell Res. 2007 Dec 10;313(20):4091-106. [PubMed:18028908 ]