You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01973
Secondary Accession Numbers
  • 7410
Name P-selectin glycoprotein ligand 1
Synonyms
  1. CD162 antigen
  2. PSGL-1
  3. Selectin P ligand
Gene Name SELPLG
Protein Type Unknown
Biological Properties
General Function Replication, recombination and repair
Specific Function A SLe(x)-type glycan, which through high affinity, calcium-dependent interactions with E-, P- and L-selectins, mediates rapid rolling of leukocytes over vascular surfaces during the initial steps in inflammation. PSGL1 is critical for the initial leukocyte capture
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24
SNPs SELPLG
Gene Sequence
>1239 bp
ATGCCTCTGCAACTCCTCCTGTTGCTGATCCTACTGGGCCCTGGCAACAGCTTGCAGCTG
TGGGACACCTGGGCAGATGAAGCCGAGAAAGCCTTGGGTCCCCTGCTTGCCCGGGACCGG
AGACAGGCCACCGAATATGAGTACCTAGATTATGATTTCCTGCCAGAAACGGAGCCTCCG
GAAATACTGAGGAACAGCACTGACACCACTCCTCTGACTGGGCCTGGAACCCCTGAGTCT
ACCACTGTGGAGCCTGCTGCAAGGCGTTCTACTGGCCTGGATGCAGGAGGGGCAGTCACA
GAGCTGACCACGGAGCTGGCCAACATGGGGAACCTGTCCACGGATTCAGCAGCTATGGAG
ATACAGACCACTCAACCAGCAGCCACGGAGGCACAGACCACTCAACCAGTGCCCACGGAG
GCACAGACCACTCCACTGGCAGCCACAGAGGCACAGACAACTCGACTGACGGCCACGGAG
GCACAGACCACTCCACTGGCAGCCACAGAGGCACAGACCACTCCACCAGCAGCCACGGAA
GCACAGACCACTCAACCCACAGGCCTGGAGGCACAGACCACTGCACCAGCAGCCATGGAG
GCACAGACCACTGCACCAGCAGCCATGGAAGCACAGACCACTCCACCAGCAGCCATGGAG
GCACAGACCACTCAAACCACAGCCATGGAGGCACAGACCACTGCACCAGAAGCCACGGAG
GCACAGACCACTCAACCCACAGCCACGGAGGCACAGACCACTCCACTGGCAGCCATGGAG
GCCCTGTCCACAGAACCCAGTGCCACAGAGGCCCTGTCCATGGAACCTACTACCAAAAGA
GGTCTGTTCATACCCTTTTCTGTGTCCTCTGTTACTCACAAGGGCATTCCCATGGCAGCC
AGCAATTTGTCCGTCAACTACCCAGTGGGGGCCCCAGACCACATCTCTGTGAAGCAGTGC
CTGCTGGCCATCCTAATCTTGGCGCTGGTGGCCACTATCTTCTTCGTGTGCACTGTGGTG
CTGGCGGTCCGCCTCTCCCGCAAGGGCCACATGTACCCCGTGCGTAATTACTCCCCCACC
GAGATGGTCTGCATCTCATCCCTGTTGCCTGATGGGGGTGAGGGGCCCTCTGCCACAGCC
AATGGGGGCCTGTCCAAGGCCAAGAGCCCGGGCCTGACGCCAGAGCCCAGGGAGGACCGT
GAGGGGGATGACCTCACCCTGCACAGCTTCCTCCCTTAG
Protein Properties
Number of Residues 412
Molecular Weight 43201.0
Theoretical pI 4.06
Pfam Domain Function Not Available
Signals
  • 1-17
Transmembrane Regions
  • 321-341
Protein Sequence
>P-selectin glycoprotein ligand 1
MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPP
EMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAME
IQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATE
AQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATE
AQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAA
SNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPT
EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP
GenBank ID Protein 194385012
UniProtKB/Swiss-Prot ID Q14242
UniProtKB/Swiss-Prot Entry Name SELPL_HUMAN
PDB IDs Not Available
GenBank Gene ID AK298738
GeneCard ID SELPLG
GenAtlas ID SELPLG
HGNC ID HGNC:10722
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  6. Veldman GM, Bean KM, Cumming DA, Eddy RL, Sait SN, Shows TB: Genomic organization and chromosomal localization of the gene encoding human P-selectin glycoprotein ligand. J Biol Chem. 1995 Jul 7;270(27):16470-5. [PubMed:7541799 ]
  7. Sako D, Chang XJ, Barone KM, Vachino G, White HM, Shaw G, Veldman GM, Bean KM, Ahern TJ, Furie B, et al.: Expression cloning of a functional glycoprotein ligand for P-selectin. Cell. 1993 Dec 17;75(6):1179-86. [PubMed:7505206 ]
  8. Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP: The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine. J Biol Chem. 1994 Sep 16;269(37):23318-27. [PubMed:7521878 ]
  9. Sako D, Comess KM, Barone KM, Camphausen RT, Cumming DA, Shaw GD: A sulfated peptide segment at the amino terminus of PSGL-1 is critical for P-selectin binding. Cell. 1995 Oct 20;83(2):323-31. [PubMed:7585949 ]
  10. Pouyani T, Seed B: PSGL-1 recognition of P-selectin is controlled by a tyrosine sulfation consensus at the PSGL-1 amino terminus. Cell. 1995 Oct 20;83(2):333-43. [PubMed:7585950 ]
  11. Wilkins PP, Moore KL, McEver RP, Cummings RD: Tyrosine sulfation of P-selectin glycoprotein ligand-1 is required for high affinity binding to P-selectin. J Biol Chem. 1995 Sep 29;270(39):22677-80. [PubMed:7559387 ]
  12. Wilkins PP, McEver RP, Cummings RD: Structures of the O-glycans on P-selectin glycoprotein ligand-1 from HL-60 cells. J Biol Chem. 1996 Aug 2;271(31):18732-42. [PubMed:8702529 ]
  13. Epperson TK, Patel KD, McEver RP, Cummings RD: Noncovalent association of P-selectin glycoprotein ligand-1 and minimal determinants for binding to P-selectin. J Biol Chem. 2000 Mar 17;275(11):7839-53. [PubMed:10713099 ]
  14. Rodgers SD, Camphausen RT, Hammer DA: Tyrosine sulfation enhances but is not required for PSGL-1 rolling adhesion on P-selectin. Biophys J. 2001 Oct;81(4):2001-9. [PubMed:11566773 ]
  15. Bernimoulin MP, Zeng XL, Abbal C, Giraud S, Martinez M, Michielin O, Schapira M, Spertini O: Molecular basis of leukocyte rolling on PSGL-1. Predominant role of core-2 O-glycans and of tyrosine sulfate residue 51. J Biol Chem. 2003 Jan 3;278(1):37-47. Epub 2002 Oct 25. [PubMed:12403782 ]
  16. Leppanen A, Yago T, Otto VI, McEver RP, Cummings RD: Model glycosulfopeptides from P-selectin glycoprotein ligand-1 require tyrosine sulfation and a core 2-branched O-glycan to bind to L-selectin. J Biol Chem. 2003 Jul 18;278(29):26391-400. Epub 2003 May 7. [PubMed:12736247 ]
  17. Schaff UY, Shih HH, Lorenz M, Sako D, Kriz R, Milarski K, Bates B, Tchernychev B, Shaw GD, Simon SI: SLIC-1/sorting nexin 20: a novel sorting nexin that directs subcellular distribution of PSGL-1. Eur J Immunol. 2008 Feb;38(2):550-64. doi: 10.1002/eji.200737777. [PubMed:18196517 ]
  18. Somers WS, Tang J, Shaw GD, Camphausen RT: Insights into the molecular basis of leukocyte tethering and rolling revealed by structures of P- and E-selectin bound to SLe(X) and PSGL-1. Cell. 2000 Oct 27;103(3):467-79. [PubMed:11081633 ]