Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02081
Secondary Accession Numbers
  • 7562
Name Apolipoprotein B-100
Synonyms
  1. Apo B-100
  2. Apo B-48
  3. Apolipoprotein B-48
Gene Name APOB
Protein Type Enzyme
Biological Properties
General Function Involved in lipid transporter activity
Specific Function Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor
Pathways Not Available
Reactions Not Available
GO Classification
Function
transporter activity
substrate-specific transporter activity
lipid transporter activity
Process
establishment of localization
transport
lipid transport
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:2
Locus 2p24-p23
SNPs APOB
Gene Sequence
>13692 bp
ATGGACCCGCCGAGGCCCGCGCTGCTGGCGCTGCTGGCGCTGCCTGCGCTGCTGCTGCTG
CTGCTGGCGGGCGCCAGGGCCGAAGAGGAAATGCTGGAAAATGTCAGCCTGGTCTGTCCA
AAAGATGCGACCCGATTCAAGCACCTCCGGAAGTACACATACAACTATGAGGCTGAGAGT
TCCAGTGGAGTCCCTGGGACTGCTGATTCAAGAAGTGCCACCAGGATCAACTGCAAGGTT
GAGCTGGAGGTTCCCCAGCTCTGCAGCTTCATCCTGAAGACCAGCCAGTGCACCCTGAAA
GAGGTGTATGGCTTCAACCCTGAGGGCAAAGCCTTGCTGAAGAAAACCAAGAACTCTGAG
GAGTTTGCTGCAGCCATGTCCAGGTATGAGCTCAAGCTGGCCATTCCAGAAGGGAAGCAG
GTTTTCCTTTACCCGGAGAAAGATGAACCTACTTACATCCTGAACATCAAGAGGGGCATC
ATTTCTGCCCTCCTGGTTCCCCCAGAGACAGAAGAAGCCAAGCAAGTGTTGTTTCTGGAT
ACCGTGTATGGAAACTGCTCCACTCACTTTACCGTCAAGACGAGGAAGGGCAATGTGGCA
ACAGAAATATCCACTGAAAGAGACCTGGGGCAGTGTGATCGCTTCAAGCCCATCCGCACA
GGCATCAGCCCACTTGCTCTCATCAAAGGCATGACCCGCCCCTTGTCAACTCTGATCAGC
AGCAGCCAGTCCTGTCAGTACACACTGGACGCTAAGAGGAAGCATGTGGCAGAAGCCATC
TGCAAGGAGCAACACCTCTTCCTGCCTTTCTCCTACAACAATAAGTATGGGATGGTAGCA
CAAGTGACACAGACTTTGAAACTTGAAGACACACCAAAGATCAACAGCCGCTTCTTTGGT
GAAGGTACTAAGAAGATGGGCCTCGCATTTGAGAGCACCAAATCCACATCACCTCCAAAG
CAGGCCGAAGCTGTTTTGAAGACTCTCCAGGAACTGAAAAAACTAACCATCTCTGAGCAA
AATATCCAGAGAGCTAATCTCTTCAATAAGCTGGTTACTGAGCTGAGAGGCCTCAGTGAT
GAAGCAGTCACATCTCTCTTGCCACAGCTGATTGAGGTGTCCAGCCCCATCACTTTACAA
GCCTTGGTTCAGTGTGGACAGCCTCAGTGCTCCACTCACATCCTCCAGTGGCTGAAACGT
GTGCATGCCAACCCCCTTCTGATAGATGTGGTCACCTACCTGGTGGCCCTGATCCCCGAG
CCCTCAGCACAGCAGCTGCGAGAGATCTTCAACATGGCGAGGGATCAGCGCAGCCGAGCC
ACCTTGTATGCGCTGAGCCACGCGGTCAACAACTATCATAAGACAAACCCTACAGGGACC
CAGGAGCTGCTGGACATTGCTAATTACCTGATGGAACAGATTCAAGATGACTGCACTGGG
GATGAAGATTACACCTATTTGATTCTGCGGGTCATTGGAAATATGGGCCAAACCATGGAG
CAGTTAACTCCAGAACTCAAGTCTTCAATCCTCAAATGTGTCCAAAGTACAAAGCCATCA
CTGATGATCCAGAAAGCTGCCATCCAGGCTCTGCGGAAAATGGAGCCTAAAGACAAGGAC
CAGGAGGTTCTTCTTCAGACTTTCCTTGATGATGCTTCTCCGGGAGATAAGCGACTGGCT
GCCTATCTTATGTTGATGAGGAGTCCTTCACAGGCAGATATTAACAAAATTGTCCAAATT
CTACCATGGGAACAGAATGAGCAAGTGAAGAACTTTGTGGCTTCCCATATTGCCAATATC
TTGAACTCAGAAGAATTGGATATCCAAGATCTGAAAAAGTTAGTGAAAGAAGCTCTGAAA
GAATCTCAACTTCCAACTGTCATGGACTTCAGAAAATTCTCTCGGAACTATCAACTCTAC
AAATCTGTTTCTCTTCCATCACTTGACCCAGCCTCAGCCAAAATAGAAGGGAATCTTATA
TTTGATCCAAATAACTACCTTCCTAAAGAAAGCATGCTGAAAACTACCCTCACTGCCTTT
GGATTTGCTTCAGCTGACCTCATCGAGATTGGCTTGGAAGGAAAAGGCTTTGAGCCAACA
TTGGAAGCTCTTTTTGGGAAGCAAGGATTTTTCCCAGACAGTGTCAACAAAGCTTTGTAC
TGGGTTAATGGTCAAGTTCCTGATGGTGTCTCTAAGGTCTTAGTGGACCACTTTGGCTAT
ACCAAAGATGATAAACATGAGCAGGATATGGTAAATGGAATAATGCTCAGTGTTGAGAAG
CTGATTAAAGATTTGAAATCCAAAGAAGTCCCGGAAGCCAGAGCCTACCTCCGCATCTTG
GGAGAGGAGCTTGGTTTTGCCAGTCTCCATGACCTCCAGCTCCTGGGAAAGCTGCTTCTG
ATGGGTGCCCGCACTCTGCAGGGGATCCCCCAGATGATTGGAGAGGTCATCAGGAAGGGC
TCAAAGAATGACTTTTTTCTTCACTACATCTTCATGGAGAATGCCTTTGAACTCCCCACT
GGAGCTGGATTACAGTTGCAAATATCTTCATCTGGAGTCATTGCTCCCGGAGCCAAGGCT
GGAGTAAAACTGGAAGTAGCCAACATGCAGGCTGAACTGGTGGCAAAACCCTCCGTGTCT
GTGGAGTTTGTGACAAATATGGGCATCATCATTCCGGACTTCGCTAGGAGTGGGGTCCAG
ATGAACACCAACTTCTTCCACGAGTCGGGTCTGGAGGCTCATGTTGCCCTAAAAGCTGGG
AAGCTGAAGTTTATCATTCCTTCCCCAAAGAGACCAGTCAAGCTGCTCAGTGGAGGCAAC
ACATTACATTTGGTCTCTACCACCAAAACGGAGGTGATCCCACCTCTCATTGAGAACAGG
CAGTCCTGGTCAGTTTGCAAGCAAGTCTTTCCTGGCCTGAATTACTGCACCTCAGGCGCT
TACTCCAACGCCAGCTCCACAGACTCCGCCTCCTACTATCCGCTGACCGGGGACACCAGA
TTAGAGCTGGAACTGAGGCCTACAGGAGAGATTGAGCAGTATTCTGTCAGCGCAACCTAT
GAGCTCCAGAGAGAGGACAGAGCCTTGGTGGATACCCTGAAGTTTGTAACTCAAGCAGAA
GGTGCGAAGCAGACTGAGGCTACCATGACATTCAAATATAATCGGCAGAGTATGACCTTG
TCCAGTGAAGTCCAAATTCCGGATTTTGATGTTGACCTCGGAACAATCCTCAGAGTTAAT
GATGAATCTACTGAGGGCAAAACGTCTTACAGACTCACCCTGGACATTCAGAACAAGAAA
ATTACTGAGGTCGCCCTCATGGGCCACCTAAGTTGTGACACAAAGGAAGAAAGAAAAATC
AAGGGTGTTATTTCCATACCCCGTTTGCAAGCAGAAGCCAGAAGTGAGATCCTCGCCCAC
TGGTCGCCTGCCAAACTGCTTCTCCAAATGGACTCATCTGCTACAGCTTATGGCTCCACA
GTTTCCAAGAGGGTGGCATGGCATTATGATGAAGAGAAGATTGAATTTGAATGGAACACA
GGCACCAATGTAGATACCAAAAAAATGACTTCCAATTTCCCTGTGGATCTCTCCGATTAT
CCTAAGAGCTTGCATATGTATGCTAATAGACTCCTGGATCACAGAGTCCCTGAAACAGAC
ATGACTTTCCGGCACGTGGGTTCCAAATTAATAGTTGCAATGAGCTCATGGCTTCAGAAG
GCATCTGGGAGTCTTCCTTATACCCAGACTTTGCAAGACCACCTCAATAGCCTGAAGGAG
TTCAACCTCCAGAACATGGGATTGCCAGACTTCCACATCCCAGAAAACCTCTTCTTAAAA
AGCGATGGCCGGGTCAAATATACCTTGAACAAGAACAGTTTGAAAATTGAGATTCCTTTG
CCTTTTGGTGGCAAATCCTCCAGAGATCTAAAGATGTTAGAGACTGTTAGGACACCAGCC
CTCCACTTCAAGTCTGTGGGATTCCATCTGCCATCTCGAGAGTTCCAAGTCCCTACTTTT
ACCATTCCCAAGTTGTATCAACTGCAAGTGCCTCTCCTGGGTGTTCTAGACCTCTCCACG
AATGTCTACAGCAACTTGTACAACTGGTCCGCCTCCTACAGTGGTGGCAACACCAGCACA
GACCATTTCAGCCTTCGGGCTCGTTACCACATGAAGGCTGACTCTGTGGTTGACCTGCTT
TCCTACAATGTGCAAGGATCTGGAGAAACAACATATGACCACAAGAATACGTTCACACTA
TCATGTGATGGGTCTCTACGCCACAAATTTCTAGATTCGAATATCAAATTCAGTCATGTA
GAAAAACTTGGAAACAACCCAGTCTCAAAAGGTTTACTAATATTCGATGCATCTAGTTCC
TGGGGACCACAGATGTCTGCTTCAGTTCATTTGGACTCCAAAAAGAAACAGCATTTGTTT
GTCAAAGAAGTCAAGATTGATGGGCAGTTCAGAGTCTCTTCGTTCTATGCTAAAGGCACA
TATGGCCTGTCTTGTCAGAGGGATCCTAACACTGGCCGGCTCAATGGAGAGTCCAACCTG
AGGTTTAACTCCTCCTACCTCCAAGGCACCAACCAGATAACAGGAAGATATGAAGATGGA
ACCCTCTCCCTCACCTCCACCTCTGATCTGCAAAGTGGCATCATTAAAAATACTGCTTCC
CTAAAGTATGAGAACTACGAGCTGACTTTAAAATCTGACACCAATGGGAAGTATAAGAAC
TTTGCCACTTCTAACAAGATGGATATGACCTTCTCTAAGCAAAATGCACTGCTGCGTTCT
GAATATCAGGCTGATTACGAGTCATTGAGGTTCTTCAGCCTGCTTTCTGGATCACTAAAT
TCCCATGGTCTTGAGTTAAATGCTGACATCTTAGGCACTGACAAAATTAATAGTGGTGCT
CACAAGGCGACACTAAGGATTGGCCAAGATGGAATATCTACCAGTGCAACGACCAACTTG
AAGTGTAGTCTCCTGGTGCTGGAGAATGAGCTGAATGCAGAGCTTGGCCTCTCTGGGGCA
TCTATGAAATTAACAACAAATGGCCGCTTCAGGGAACACAATGCAAAATTCAGTCTGGAT
GGGAAAGCCGCCCTCACAGAGCTATCACTGGGAAGTGCTTATCAGGCCATGATTCTGGGT
GTCGACAGCAAAAACATTTTCAACTTCAAGGTCAGTCAAGAAGGACTTAAGCTCTCAAAT
GACATGATGGGCTCATATGCTGAAATGAAATTTGACCACACAAACAGTCTGAACATTGCA
GGCTTATCACTGGACTTCTCTTCAAAACTTGACAACATTTACAGCTCTGACAAGTTTTAT
AAGCAAACTGTTAATTTACAGCTACAGCCCTATTCTCTGGTAACTACTTTAAACAGTGAC
CTGAAATACAATGCTCTGGATCTCACCAACAATGGGAAACTACGGCTAGAACCCCTGAAG
CTGCATGTGGCTGGTAACCTAAAAGGAGCCTACCAAAATAATGAAATAAAACACATCTAT
GCCATCTCTTCTGCTGCCTTATCAGCAAGCTATAAAGCAGACACTGTTGCTAAGGTTCAG
GGTGTGGAGTTTAGCCATCGGCTCAACACAGACATCGCTGGGCTGGCTTCAGCCATTGAC
ATGAGCACAAACTATAATTCAGACTCACTGCATTTCAGCAATGTCTTCCGTTCTGTAATG
GCCCCGTTTACCATGACCATCGATGCACATACAAATGGCAATGGGAAACTCGCTCTCTGG
GGAGAACATACTGGGCAGCTGTATAGCAAATTCCTGTTGAAAGCAGAACCTCTGGCATTT
ACTTTCTCTCATGATTACAAAGGCTCCACAAGTCATCATCTCGTGTCTAGGAAAAGCATC
AGTGCAGCTCTTGAACACAAAGTCAGTGCCCTGCTTACTCCAGCTGAGCAGACAGGCACC
TGGAAACTCAAGACCCAATTTAACAACAATGAATACAGCCAGGACTTGGATGCTTACAAC
ACTAAAGATAAAATTGGCGTGGAGCTTACTGGACGAACTCTGGCTGACCTAACTCTACTA
GACTCCCCAATTAAAGTGCCACTTTTACTCAGTGAGCCCATCAATATCATTGATGCTTTA
GAGATGAGAGATGCCGTTGAGAAGCCCCAAGAATTTACAATTGTTGCTTTTGTAAAGTAT
GATAAAAACCAAGATGTTCACTCCATTAACCTCCCATTTTTTGAGACCTTGCAAGAATAT
TTTGAGAGGAATCGACAAACCATTATAGTTGTAGTGGAAAACGTACAGAGAAACCTGAAG
CACATCAATATTGATCAATTTGTAAGAAAATACAGAGCAGCCCTGGGAAAACTCCCACAG
CAAGCTAATGATTATCTGAATTCATTCAATTGGGAGAGACAAGTTTCACATGCCAAGGAG
AAACTGACTGCTCTCACAAAAAAGTATAGAATTACAGAAAATGATATACAAATTGCATTA
GATGATGCCAAAATCAACTTTAATGAAAAACTATCTCAACTGCAGACATATATGATACAA
TTTGATCAGTATATTAAAGATAGTTATGATTTACATGATTTGAAAATAGCTATTGCTAAT
ATTATTGATGAAATCATTGAAAAATTAAAAAGTCTTGATGAGCACTATCATATCCGTGTA
AATTTAGTAAAAACAATCCATGATCTACATTTGTTTATTGAAAATATTGATTTTAACAAA
AGTGGAAGTAGTACTGCATCCTGGATTCAAAATGTGGATACTAAGTACCAAATCAGAATC
CAGATACAAGAAAAACTGCAGCAGCTTAAGAGACACATACAGAATATAGACATCCAGCAC
CTAGCTGGAAAGTTAAAACAACACATTGAGGCTATTGATGTTAGAGTGCTTTTAGATCAA
TTGGGAACTACAATTTCATTTGAAAGAATAAATGATGTTCTTGAGCATGTCAAACACTTT
GTTATAAATCTTATTGGGGATTTTGAAGTAGCTGAGAAAATCAATGCCTTCAGAGCCAAA
GTCCATGAGTTAATCGAGAGGTATGAAGTAGACCAACAAATCCAGGTTTTAATGGATAAA
TTAGTAGAGTTGACCCACCAATACAAGTTGAAGGAGACTATTCAGAAGCTAAGCAATGTC
CTACAACAAGTTAAGATAAAAGATTACTTTGAGAAATTGGTTGGATTTATTGATGATGCT
GTGAAGAAGCTTAATGAATTATCTTTTAAAACATTCATTGAAGATGTTAACAAATTCCTT
GACATGTTGATAAAGAAATTAAAGTCATTTGATTACCACCAGTTTGTAGATGAAACCAAT
GACAAAATCCGTGAGGTGACTCAGAGACTCAATGGTGAAATTCAGGCTCTGGAACTACCA
CAAAAAGCTGAAGCATTAAAACTGTTTTTAGAGGAAACCAAGGCCACAGTTGCAGTGTAT
CTGGAAAGCCTACAGGACACCAAAATAACCTTAATCATCAATTGGTTACAGGAGGCTTTA
AGTTCAGCATCTTTGGCTCACATGAAGGCCAAATTCCGAGAGACTCTAGAAGATACACGA
GACCGAATGTATCAAATGGACATTCAGCAGGAACTTCAACGATACCTGTCTCTGGTAGGC
CAGGTTTATAGCACACTTGTCACCTACATTTCTGATTGGTGGACTCTTGCTGCTAAGAAC
CTTACTGACTTTGCAGAGCAATATTCTATCCAAGATTGGGCTAAACGTATGAAAGCATTG
GTAGAGCAAGGGTTCACTGTTCCTGAAATCAAGACCATCCTTGGGACCATGCCTGCCTTT
GAAGTCAGTCTTCAGGCTCTTCAGAAAGCTACCTTCCAGACACCTGATTTTATAGTCCCC
CTAACAGATTTGAGGATTCCATCAGTTCAGATAAACTTCAAAGACTTAAAAAATATAAAA
ATCCCATCCAGGTTTTCCACACCAGAATTTACCATCCTTAACACCTTCCACATTCCTTCC
TTTACAATTGACTTTGTCGAAATGAAAGTAAAGATCATCAGAACCATTGACCAGATGCAG
AACAGTGAGCTGCAGTGGCCCGTTCCAGATATATATCTCAGGGATCTGAAGGTGGAGGAC
ATTCCTCTAGCGAGAATCACCCTGCCAGACTTCCGTTTACCAGAAATCGCAATTCCAGAA
TTCATAATCCCAACTCTCAACCTTAATGATTTTCAAGTTCCTGACCTTCACATACCAGAA
TTCCAGCTTCCCCACATCTCACACACAATTGAAGTACCTACTTTTGGCAAGCTATACAGT
ATTCTGAAAATCCAATCTCCTCTTTTCACATTAGATGCAAATGCTGACATAGGGAATGGA
ACCACCTCAGCAAACGAAGCAGGTATCGCAGCTTCCATCACTGCCAAAGGAGAGTCCAAA
TTAGAAGTTCTCAATTTTGATTTTCAAGCAAATGCACAACTCTCAAACCCTAAGATTAAT
CCGCTGGCTCTGAAGGAGTCAGTGAAGTTCTCCAGCAAGTACCTGAGAACGGAGCATGGG
AGTGAAATGCTGTTTTTTGGAAATGCTATTGAGGGAAAATCAAACACAGTGGCAAGTTTA
CACACAGAAAAAAATACACTGGAGCTTAGTAATGGAGTGATTGTCAAGATAAACAATCAG
CTTACCCTGGATAGCAACACTAAATACTTCCACAAATTGAACATCCCCAAACTGGACTTC
TCTAGTCAGGCTGACCTGCGCAACGAGATCAAGACACTGTTGAAAGCTGGCCACATAGCA
TGGACTTCTTCTGGAAAAGGGTCATGGAAATGGGCCTGCCCCAGATTCTCAGATGAGGGA
ACACATGAATCACAAATTAGTTTCACCATAGAAGGACCCCTCACTTCCTTTGGACTGTCC
AATAAGATCAATAGCAAACACCTAAGAGTAAACCAAAACTTGGTTTATGAATCTGGCTCC
CTCAACTTTTCTAAACTTGAAATTCAATCACAAGTCGATTCCCAGCATGTGGGCCACAGT
GTTCTAACTGCTAAAGGCATGGCACTGTTTGGAGAAGGGAAGGCAGAGTTTACTGGGAGG
CATGATGCTCATTTAAATGGAAAGGTTATTGGAACTTTGAAAAATTCTCTTTTCTTTTCA
GCCCAGCCATTTGAGATCACGGCATCCACAAACAATGAAGGGAATTTGAAAGTTCGTTTT
CCATTAAGGTTAACAGGGAAGATAGACTTCCTGAATAACTATGCACTGTTTCTGAGTCCC
AGTGCCCAGCAAGCAAGTTGGCAAGTAAGTGCTAGGTTCAATCAGTATAAGTACAACCAA
AATTTCTCTGCTGGAAACAACGAGAACATTATGGAGGCCCATGTAGGAATAAATGGAGAA
GCAAATCTGGATTTCTTAAACATTCCTTTAACAATTCCTGAAATGCGTCTACCTTACACA
ATAATCACAACTCCTCCACTGAAAGATTTCTCTCTATGGGAAAAAACAGGCTTGAAGGAA
TTCTTGAAAACGACAAAGCAATCATTTGATTTAAGTGTAAAAGCTCAGTATAAGAAAAAC
AAACACAGGCATTCCATCACAAATCCTTTGGCTGTGCTTTGTGAGTTTATCAGTCAGAGC
ATCAAATCCTTTGACAGGCATTTTGAAAAAAACAGAAACAATGCATTAGATTTTGTCACC
AAATCCTATAATGAAACAAAAATTAAGTTTGATAAGTACAAAGCTGAAAAATCTCACGAC
GAGCTCCCCAGGACCTTTCAAATTCCTGGATACACTGTTCCAGTTGTCAATGTTGAAGTG
TCTCCATTCACCATAGAGATGTCGGCATTCGGCTATGTGTTCCCAAAAGCAGTCAGCATG
CCTAGTTTCTCCATCCTAGGTTCTGACGTCCGTGTGCCTTCATACACATTAATCCTGCCA
TCATTAGAGCTGCCAGTCCTTCATGTCCCTAGAAATCTCAAGCTTTCTCTTCCACATTTC
AAGGAATTGTGTACCATAAGCCATATTTTTATTCCTGCCATGGGCAATATTACCTATGAT
TTCTCCTTTAAATCAAGTGTCATCACACTGAATACCAATGCTGAACTTTTTAACCAGTCA
GATATTGTTGCTCATCTCCTTTCTTCATCTTCATCTGTCATTGATGCACTGCAGTACAAA
TTAGAGGGCACCACAAGATTGACAAGAAAAAGGGGATTGAAGTTAGCCACAGCTCTGTCT
CTGAGCAACAAATTTGTGGAGGGTAGTCATAACAGTACTGTGAGCTTAACCACGAAAAAT
ATGGAAGTGTCAGTGGCAAAAACCACAAAAGCCGAAATTCCAATTTTGAGAATGAATTTC
AAGCAAGAACTTAATGGAAATACCAAGTCAAAACCTACTGTCTCTTCCTCCATGGAATTT
AAGTATGATTTCAATTCTTCAATGCTGTACTCTACCGCTAAAGGAGCAGTTGACCACAAG
CTTAGCTTGGAAAGCCTCACCTCTTACTTTTCCATTGAGTCATCTACCAAAGGAGATGTC
AAGGGTTCGGTTCTTTCTCGGGAATATTCAGGAACTATTGCTAGTGAGGCCAACACTTAC
TTGAATTCCAAGAGCACACGGTCTTCAGTGAAGCTGCAGGGCACTTCCAAAATTGATGAT
ATCTGGAACCTTGAAGTAAAAGAAAATTTTGCTGGAGAAGCCACACTCCAACGCATATAT
TCCCTCTGGGAGCACAGTACGAAAAACCACTTACAGCTAGAGGGCCTCTTTTTCACCAAC
GGAGAACATACAAGCAAAGCCACCCTGGAACTCTCTCCATGGCAAATGTCAGCTCTTGTT
CAGGTCCATGCAAGTCAGCCCAGTTCCTTCCATGATTTCCCTGACCTTGGCCAGGAAGTG
GCCCTGAATGCTAACACTAAGAACCAGAAGATCAGATGGAAAAATGAAGTCCGGATTCAT
TCTGGGTCTTTCCAGAGCCAGGTCGAGCTTTCCAATGACCAAGAAAAGGCACACCTTGAC
ATTGCAGGATCCTTAGAAGGACACCTAAGGTTCCTCAAAAATATCATCCTACCAGTCTAT
GACAAGAGCTTATGGGATTTCCTAAAGCTGGATGTAACCACCAGCATTGGTAGGAGACAG
CATCTTCGTGTTTCAACTGCCTTTGTGTACACCAAAAACCCCAATGGCTATTCATTCTCC
ATCCCTGTAAAAGTTTTGGCTGATAAATTCATTACTCCTGGGCTGAAACTAAATGATCTA
AATTCAGTTCTTGTCATGCCTACGTTCCATGTCCCATTTACAGATCTTCAGGTTCCATCG
TGCAAACTTGACTTCAGAGAAATACAAATCTATAAGAAGCTGAGAACTTCATCATTTGCC
CTCAACCTACCAACACTCCCCGAGGTAAAATTCCCTGAAGTTGATGTGTTAACAAAATAT
TCTCAACCAGAAGACTCCTTGATTCCCTTTTTTGAGATAACCGTGCCTGAATCTCAGTTA
ACTGTGTCCCAGTTCACGCTTCCAAAAAGTGTTTCAGATGGCATTGCTGCTTTGGATCTA
AATGCAGTAGCCAACAAGATCGCAGACTTTGAGTTGCCCACCATCATCGTGCCTGAGCAG
ACCATTGAGATTCCCTCCATTAAGTTCTCTGTACCTGCTGGAATTGTCATTCCTTCCTTT
CAAGCACTGACTGCACGCTTTGAGGTAGACTCTCCCGTGTATAATGCCACTTGGAGTGCC
AGTTTGAAAAACAAAGCAGATTATGTTGAAACAGTCCTGGATTCCACATGCAGCTCAACC
GTACAGTTCCTAGAATATGAACTAAATGTTTTGGGAACACACAAAATCGAAGATGGTACG
TTAGCCTCTAAGACTAAAGGAACACTTGCACACCGTGACTTCAGTGCAGAATATGAAGAA
GATGGCAAATTTGAAGGACTTCAGGAATGGGAAGGAAAAGCGCACCTCAATATCAAAAGC
CCAGCGTTCACCGATCTCCATCTGCGCTACCAGAAAGACAAGAAAGGCATCTCCACCTCA
GCAGCCTCCCCAGCCGTAGGCACCGTGGGCATGGATATGGATGAAGATGACGACTTTTCT
AAATGGAACTTCTACTACAGCCCTCAGTCCTCTCCAGATAAAAAACTCACCATATTCAAA
ACTGAGTTGAGGGTCCGGGAATCTGATGAGGAAACTCAGATCAAAGTTAATTGGGAAGAA
GAGGCAGCTTCTGGCTTGCTAACCTCTCTGAAAGACAACGTGCCCAAGGCCACAGGGGTC
CTTTATGATTATGTCAACAAGTACCACTGGGAACACACAGGGCTCACCCTGAGAGAAGTG
TCTTCAAAGCTGAGAAGAAATCTGCAGAACAATGCTGAGTGGGTTTATCAAGGGGCCATT
AGGCAAATTGATGATATCGACGTGAGGTTCCAGAAAGCAGCCAGTGGCACCACTGGGACC
TACCAAGAGTGGAAGGACAAGGCCCAGAATCTGTACCAGGAACTGTTGACTCAGGAAGGC
CAAGCCAGTTTCCAGGGACTCAAGGATAACGTGTTTGATGGCTTGGTACGAGTTACTCAA
AAATTCCATATGAAAGTCAAGCATCTGATTGACTCACTCATTGATTTTCTGAACTTCCCC
AGATTCCAGTTTCCGGGGAAACCTGGGATATACACTAGGGAGGAACTTTGCACTATGTTC
ATAAGGGAGGTAGGGACGGTACTGTCCCAGGTATATTCGAAAGTCCATAATGGTTCAGAA
ATACTGTTTTCCTATTTCCAAGACCTAGTGATTACACTTCCTTTCGAGTTAAGGAAACAT
AAACTAATAGATGTAATCTCGATGTATAGGGAACTGTTGAAAGATTTATCAAAAGAAGCC
CAAGAGGTATTTAAAGCCATTCAGTCTCTCAAGACCACAGAGGTGCTACGTAATCTTCAG
GACCTTTTACAATTCATTTTCCAACTAATAGAAGATAACATTAAACAGCTGAAAGAGATG
AAATTTACTTATCTTATTAATTATATCCAAGATGAGATCAACACAATCTTCAATGATTAT
ATCCCATATGTTTTTAAATTGTTGAAAGAAAACCTATGCCTTAATCTTCATAAGTTCAAT
GAATTTATTCAAAACGAGCTTCAGGAAGCTTCTCAAGAGTTACAGCAGATCCATCAATAC
ATTATGGCCCTTCGTGAAGAATATTTTGATCCAAGTATAGTTGGCTGGACAGTGAAATAT
TATGAACTTGAAGAAAAGATAGTCAGTCTGATCAAGAACCTGTTAGTTGCTCTTAAGGAC
TTCCATTCTGAATATATTGTCAGTGCCTCTAACTTTACTTCCCAACTCTCAAGTCAAGTT
GAGCAATTTCTGCACAGAAATATTCAGGAATATCTTAGCATCCTTACCGATCCAGATGGA
AAAGGGAAAGAGAAGATTGCAGAGCTTTCTGCCACTGCTCAGGAAATAATTAAAAGCCAG
GCCATTGCGACGAAGAAAATAATTTCTGATTACCACCAGCAGTTTAGATATAAACTGCAA
GATTTTTCAGACCAACTCTCTGATTACTATGAAAAATTTATTGCTGAATCCAAAAGATTG
ATTGACCTGTCCATTCAAAACTACCACACATTTCTGATATACATCACGGAGTTACTGAAA
AAGCTGCAATCAACCACAGTCATGAACCCCTACATGAAGCTTGCTCCAGGAGAACTTACT
ATCATCCTCTAA
Protein Properties
Number of Residues 4563
Molecular Weight 515600.1
Theoretical pI 7.04
Pfam Domain Function
Signals
  • 1-27
Transmembrane Regions
  • None
Protein Sequence
>Apolipoprotein B-100
MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAES
SSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSE
EFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLD
TVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLIS
SSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFG
EGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSD
EAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPE
PSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTG
DEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKD
QEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANI
LNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLI
FDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALY
WVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRIL
GEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPT
GAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQ
MNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENR
QSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATY
ELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVN
DESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAH
WSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDY
PKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKE
FNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPA
LHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTST
DHFSLRARYHMKADSVVDLLSYNVQGSGETTYDHKNTFTLSYDGSLRHKFLDSNIKFSHV
EKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGT
YGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTAS
LKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLN
SHGLELNADILGTDKINSGAHKATLRIGQDGISTSATTNLKCSLLVLENELNAELGLSGA
SMKLTTNGRFREHNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSN
DMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSD
LKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQ
GVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVMAPFTMTIDAHTNGNGKLALW
GEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGT
WKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDAL
EMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLK
HINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIAL
DDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIANIIDEIIEKLKSLDEHYHIRV
NLVKTIHDLHLFIENIDFNKSGSSTASWIQNVDTKYQIRIQIQEKLQQLKRHIQNIDIQH
LAGKLKQHIEAIDVRVLLDQLGTTISFERINDILEHVKHFVINLIGDFEVAEKINAFRAK
VHELIERYEVDQQIQVLMDKLVELAHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDA
VKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRLNGEIQALELP
QKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEALSSASLAHMKAKFRETLEDTR
DRMYQMDIQQELQRYLSLVGQVYSTLVTYISDWWTLAAKNLTDFAEQYSIQDWAKRMKAL
VEQGFTVPEIKTILGTMPAFEVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIK
IPSRFSTPEFTILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQWPVPDIYLRDLKVED
IPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTIEVPTFGKLYS
ILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESKLEVLNFDFQANAQLSNPKIN
PLALKESVKFSSKYLRTEHGSEMLFFGNAIEGKSNTVASLHTEKNTLELSNGVIVKINNQ
LTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEG
THESQISFTIEGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHS
VLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVRF
PLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQNFSAGNNENIMEAHVGINGE
ANLDFLNIPLTIPEMRLPYTIITTPPLKDFSLWEKTGLKEFLKTTKQSFDLSVKAQYKKN
KHRHSITNPLAVLCEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHD
ELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILP
SLELPVLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYDFSFKSSVITLNTNAELFNQS
DIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKN
MEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVDHK
LSLESLTSYFSIESSTKGDVKGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDD
IWNLEVKENFAGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALV
QVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVELSNDQEKAHLD
IAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQHLRVSTAFVYTKNPNGYSFS
IPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPFTDLQVPSCKLDFREIQIYKKLRTSSFA
LNLPTLPEVKFPEVDVLTKYSQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDL
NAVANKIADFELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSA
SLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTFAHRDFSAEYEE
DGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTSAASPAVGTVGMDMDEDDDFS
KWNFYYSPQSSPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV
LYDYVNKYHWEHTGLTLREVSSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGT
YQEWKDKAQNLYQELLTQEGQASFQGLKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFP
RFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLVITLPFELRKH
KLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQDLLQFIFQLIEDNIKQLKEM
KFTYLINYIQDEINTIFSDYIPYVFKLLKENLCLNLHKFNEFIQNELQEASQELQQIHQY
IMALREEYFDPSIVGWTVKYYELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQV
EQFLHRNIQEYLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQ
DFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNPYMKLAPGELT
IIL
GenBank ID Protein 34331
UniProtKB/Swiss-Prot ID P04114
UniProtKB/Swiss-Prot Entry Name APOB_HUMAN
PDB IDs Not Available
GenBank Gene ID X04506
GeneCard ID APOB
GenAtlas ID APOB
HGNC ID HGNC:603
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  6. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  7. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  8. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [PubMed:14760718 ]
  9. Leong WF, Chow VT: Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection. Cell Microbiol. 2006 Apr;8(4):565-80. [PubMed:16548883 ]
  10. Lancellotti S, Di Leo E, Penacchioni JY, Balli F, Viola L, Bertolini S, Calandra S, Tarugi P: Hypobetalipoproteinemia with an apparently recessive inheritance due to a "de novo" mutation of apolipoprotein B. Biochim Biophys Acta. 2004 Jan 20;1688(1):61-7. [PubMed:14732481 ]
  11. Knott TJ, Wallis SC, Powell LM, Pease RJ, Lusis AJ, Blackhart B, McCarthy BJ, Mahley RW, Levy-Wilson B, Scott J: Complete cDNA and derived protein sequence of human apolipoprotein B-100. Nucleic Acids Res. 1986 Sep 25;14(18):7501-3. [PubMed:3763409 ]
  12. Ludwig EH, Blackhart BD, Pierotti VR, Caiati L, Fortier C, Knott T, Scott J, Mahley RW, Levy-Wilson B, McCarthy BJ: DNA sequence of the human apolipoprotein B gene. DNA. 1987 Aug;6(4):363-72. [PubMed:3652907 ]
  13. Chen SH, Yang CY, Chen PF, Setzer D, Tanimura M, Li WH, Gotto AM Jr, Chan L: The complete cDNA and amino acid sequence of human apolipoprotein B-100. J Biol Chem. 1986 Oct 5;261(28):12918-21. [PubMed:3759943 ]
  14. Law SW, Grant SM, Higuchi K, Hospattankar A, Lackner K, Lee N, Brewer HB Jr: Human liver apolipoprotein B-100 cDNA: complete nucleic acid and derived amino acid sequence. Proc Natl Acad Sci U S A. 1986 Nov;83(21):8142-6. [PubMed:3464946 ]
  15. Cladaras C, Hadzopoulou-Cladaras M, Nolte RT, Atkinson D, Zannis VI: The complete sequence and structural analysis of human apolipoprotein B-100: relationship between apoB-100 and apoB-48 forms. EMBO J. 1986 Dec 20;5(13):3495-507. [PubMed:3030729 ]
  16. Protter AA, Hardman DA, Sato KY, Schilling JW, Yamanaka M, Hort YJ, Hjerrild KA, Chen GC, Kane JP: Analysis of cDNA clones encoding the entire B-26 region of human apolipoprotein B. Proc Natl Acad Sci U S A. 1986 Aug;83(15):5678-82. [PubMed:3461454 ]
  17. Protter AA, Hardman DA, Schilling JW, Miller J, Appleby V, Chen GC, Kirsher SW, McEnroe G, Kane JP: Isolation of a cDNA clone encoding the amino-terminal region of human apolipoprotein B. Proc Natl Acad Sci U S A. 1986 Mar;83(5):1467-71. [PubMed:3513177 ]
  18. Yang CY, Kim TW, Weng SA, Lee BR, Yang ML, Gotto AM Jr: Isolation and characterization of sulfhydryl and disulfide peptides of human apolipoprotein B-100. Proc Natl Acad Sci U S A. 1990 Jul;87(14):5523-7. [PubMed:2115173 ]
  19. Law SW, Lackner KJ, Hospattankar AV, Anchors JM, Sakaguchi AY, Naylor SL, Brewer HB Jr: Human apolipoprotein B-100: cloning, analysis of liver mRNA, and assignment of the gene to chromosome 2. Proc Natl Acad Sci U S A. 1985 Dec;82(24):8340-4. [PubMed:3001697 ]
  20. Deeb SS, Motulsky AG, Albers JJ: A partial cDNA clone for human apolipoprotein B. Proc Natl Acad Sci U S A. 1985 Aug;82(15):4983-6. [PubMed:3860836 ]
  21. LeBoeuf RC, Miller C, Shively JE, Schumaker VN, Balla MA, Lusis AJ: Human apolipoprotein B: partial amino acid sequence. FEBS Lett. 1984 May 7;170(1):105-8. [PubMed:6373369 ]
  22. Huang LS, Ripps ME, Korman SH, Deckelbaum RJ, Breslow JL: Hypobetalipoproteinemia due to an apolipoprotein B gene exon 21 deletion derived by Alu-Alu recombination. J Biol Chem. 1989 Jul 5;264(19):11394-400. [PubMed:2567736 ]
  23. Carlsson P, Darnfors C, Olofsson SO, Bjursell G: Analysis of the human apolipoprotein B gene; complete structure of the B-74 region. Gene. 1986;49(1):29-51. [PubMed:2883086 ]
  24. Hardman DA, Protter AA, Chen GC, Schilling JW, Sato KY, Lau K, Yamanaka M, Mikita T, Miller J, Crisp T, et al.: Structural comparison of human apolipoproteins B-48 and B-100. Biochemistry. 1987 Aug 25;26(17):5478-86. [PubMed:3676265 ]
  25. Carlsson P, Olofsson SO, Bondjers G, Darnfors C, Wiklund O, Bjursell G: Molecular cloning of human apolipoprotein B cDNA. Nucleic Acids Res. 1985 Dec 20;13(24):8813-26. [PubMed:3841204 ]
  26. Powell LM, Wallis SC, Pease RJ, Edwards YH, Knott TJ, Scott J: A novel form of tissue-specific RNA processing produces apolipoprotein-B48 in intestine. Cell. 1987 Sep 11;50(6):831-40. [PubMed:3621347 ]
  27. Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer HB Jr: Human apolipoprotein B (apoB) mRNA: identification of two distinct apoB mRNAs, an mRNA with the apoB-100 sequence and an apoB mRNA containing a premature in-frame translational stop codon, in both liver and intestine. Proc Natl Acad Sci U S A. 1988 Mar;85(6):1772-6. [PubMed:2450346 ]
  28. Hardman DA, Protter AA, Schilling JW, Kane JP: Carboxyl terminal analysis of human B-48 protein confirms the novel mechanism proposed for chain termination. Biochem Biophys Res Commun. 1987 Dec 31;149(3):1214-9. [PubMed:3426612 ]
  29. Hospattankar AV, Higuchi K, Law SW, Meglin N, Brewer HB Jr: Identification of a novel in-frame translational stop codon in human intestine apoB mRNA. Biochem Biophys Res Commun. 1987 Oct 14;148(1):279-85. [PubMed:2445342 ]
  30. Mehrabian M, Schumaker VN, Fareed GC, West R, Johnson DF, Kirchgessner T, Lin HC, Wang XB, Ma YH, Mendiaz E, et al.: Human apolipoprotein B: identification of cDNA clones and characterization of mRNA. Nucleic Acids Res. 1985 Oct 11;13(19):6937-53. [PubMed:3903660 ]
  31. Knott TJ, Rall SC Jr, Innerarity TL, Jacobson SF, Urdea MS, Levy-Wilson B, Powell LM, Pease RJ, Eddy R, Nakai H, et al.: Human apolipoprotein B: structure of carboxyl-terminal domains, sites of gene expression, and chromosomal localization. Science. 1985 Oct 4;230(4721):37-43. [PubMed:2994225 ]
  32. Wei CF, Chen SH, Yang CY, Marcel YL, Milne RW, Li WH, Sparrow JT, Gotto AM Jr, Chan L: Molecular cloning and expression of partial cDNAs and deduced amino acid sequence of a carboxyl-terminal fragment of human apolipoprotein B-100. Proc Natl Acad Sci U S A. 1985 Nov;82(21):7265-9. [PubMed:2932736 ]
  33. Shoulders CC, Myant NB, Sidoli A, Rodriguez JC, Cortese C, Baralle FE, Cortese R: Molecular cloning of human LDL apolipoprotein B cDNA. Evidence for more than one gene per haploid genome. Atherosclerosis. 1985 Dec;58(1-3):277-89. [PubMed:3841481 ]
  34. Pfitzner R, Wagener R, Stoffel W: Isolation, expression and characterization of a human apolipoprotein B 100-specific cDNA clone. Biol Chem Hoppe Seyler. 1986 Oct;367(10):1077-83. [PubMed:3024665 ]
  35. Chen SH, Habib G, Yang CY, Gu ZW, Lee BR, Weng SA, Silberman SR, Cai SJ, Deslypere JP, Rosseneu M, et al.: Apolipoprotein B-48 is the product of a messenger RNA with an organ-specific in-frame stop codon. Science. 1987 Oct 16;238(4825):363-6. [PubMed:3659919 ]
  36. Knott TJ, Pease RJ, Powell LM, Wallis SC, Rall SC Jr, Innerarity TL, Blackhart B, Taylor WH, Marcel Y, Milne R, et al.: Complete protein sequence and identification of structural domains of human apolipoprotein B. Nature. 1986 Oct 23-29;323(6090):734-8. [PubMed:3773997 ]
  37. Yang CY, Chen SH, Gianturco SH, Bradley WA, Sparrow JT, Tanimura M, Li WH, Sparrow DA, DeLoof H, Rosseneu M, et al.: Sequence, structure, receptor-binding domains and internal repeats of human apolipoprotein B-100. Nature. 1986 Oct 23-29;323(6090):738-42. [PubMed:3095664 ]
  38. Dashti N, Lee DM, Mok T: Apolipoprotein B is a calcium binding protein. Biochem Biophys Res Commun. 1986 May 29;137(1):493-9. [PubMed:3087360 ]
  39. Zhao Y, McCabe JB, Vance J, Berthiaume LG: Palmitoylation of apolipoprotein B is required for proper intracellular sorting and transport of cholesteroyl esters and triglycerides. Mol Biol Cell. 2000 Feb;11(2):721-34. [PubMed:10679026 ]
  40. Navajas M, Laurent AM, Moreel JF, Ragab A, Cambou JP, Cuny G, Cambien F, Roizes G: Detection by denaturing gradient gel electrophoresis of a new polymorphism in the apolipoprotein B gene. Hum Genet. 1990 Nov;86(1):91-3. [PubMed:1979313 ]
  41. Soria LF, Ludwig EH, Clarke HR, Vega GL, Grundy SM, McCarthy BJ: Association between a specific apolipoprotein B mutation and familial defective apolipoprotein B-100. Proc Natl Acad Sci U S A. 1989 Jan;86(2):587-91. [PubMed:2563166 ]
  42. Huang LS, Gavish D, Breslow JL: Sequence polymorphism in the human apoB gene at position 8344. Nucleic Acids Res. 1990 Oct 11;18(19):5922. [PubMed:2216805 ]
  43. Pullinger CR, Hennessy LK, Chatterton JE, Liu W, Love JA, Mendel CM, Frost PH, Malloy MJ, Schumaker VN, Kane JP: Familial ligand-defective apolipoprotein B. Identification of a new mutation that decreases LDL receptor binding affinity. J Clin Invest. 1995 Mar;95(3):1225-34. [PubMed:7883971 ]
  44. Poirier O, Ricard S, Behague I, Souriau C, Evans AE, Arveiler D, Marques-Vidal P, Luc G, Roizes G, Cambien F: Detection of new variants in the apolipoprotein B (Apo B) gene by PCR-SSCP. Hum Mutat. 1996;8(3):282-5. [PubMed:8889592 ]
  45. Rabes JP, Varret M, Saint-Jore B, Erlich D, Jondeau G, Krempf M, Giraudet P, Junien C, Boileau C: Familial ligand-defective apolipoprotein B-100: simultaneous detection of the ARG3500-->GLN and ARG3531-->CYS mutations in a French population. Hum Mutat. 1997;10(2):160-3. [PubMed:9259199 ]
  46. Leren TP, Bakken KS, Hoel V, Hjermann I, Berg K: Screening for mutations of the apolipoprotein B gene causing hypocholesterolemia. Hum Genet. 1998 Jan;102(1):44-9. [PubMed:9490296 ]
  47. Burnett JR, Shan J, Miskie BA, Whitfield AJ, Yuan J, Tran K, McKnight CJ, Hegele RA, Yao Z: A novel nontruncating APOB gene mutation, R463W, causes familial hypobetalipoproteinemia. J Biol Chem. 2003 Apr 11;278(15):13442-52. Epub 2003 Jan 27. [PubMed:12551903 ]