You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02255
Secondary Accession Numbers
  • 7740
  • HMDBP07390
Name Phosphatidylserine decarboxylase proenzyme
Synonyms
  1. Phosphatidylserine decarboxylase alpha chain
  2. Phosphatidylserine decarboxylase beta chain
  3. SubName: Phosphatidylserine decarboxylase, isoform CRA_a
Gene Name PISD
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatidylserine decarboxylase activity
Specific Function Not Available
Pathways
  • Glycerophospholipid metabolism
  • Phosphatidylcholine Biosynthesis
  • Phosphatidylcholine Biosynthesis PC(11D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(9D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9M5)
  • Phosphatidylethanolamine Biosynthesis
  • phosphatidylethanolamine biosynthesis
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9M5)
  • Phospholipid Biosynthesis
Reactions
Phosphatidyl-L-serine → Phosphatidylethanolamine + CO(2) details
Phosphatidylserine → Phosphatidylethanolamine + Carbon dioxide details
GO Classification
Biological Process
small molecule metabolic process
phosphatidylethanolamine biosynthetic process
Cellular Component
mitochondrion
nucleus
Function
catalytic activity
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
phosphatidylserine decarboxylase activity
Molecular Function
phosphatidylserine decarboxylase activity
Process
metabolic process
phospholipid biosynthetic process
organophosphate metabolic process
phospholipid metabolic process
Cellular Location
  1. Mitochondrion
Gene Properties
Chromosome Location 22
Locus 22q12.2
SNPs PISD
Gene Sequence
>1128 bp
ATGATGTGTCAGTCAGAGGCGCGGCAAGGACCAGAGCTCCGCGCGGCGAAATGGTTGCAC
TTCCCCCAGCTGGCCCTGAGGCGGAGGCTGGGGCAGCTGAGCTGCATGTCCAGACCCGCT
CTGAAACTGCGCTCCTGGCCCTTGACCGTCCTCTACTACCTCCTGCCCTTCGGCGCCCTC
AGACCGCTCAGCCGGGTGGGATGGAGGCCCGTAAGCAGGGTGGCTTTGTACAAGTCAGTG
CCAACGCGCTTGCTGTCACGGGCCTGGGGTCGCCTCAATCAGGTGGAGCTGCCACACTGG
CTGCGCAGGCCCGTCTACAGCCTGTACATCTGGACGTTTGGGGTGAACATGAAAGAGGCC
GCTGTGGAGGACCTGCATCACTACCGCAACCTCAGCGAGTTCTTCCGGCGCAAGCTGAAG
CCGCAGGCCCGGCCTGTCTGTGGCCTGCACAGCGTGATTAGCCCATCGGATGGAAGGATC
CTCAACTTTGGGCAGGTGAAGAACTGTGAGGTGGAGCAGGTAAAGGGGGTCACCTACTCC
CTGGAGTCGTTCCTGGGCCCGCGTATGTGCACAGAGGACCTGCCCTTCCCACCAGCCGCG
TCGTGTGACTCCTTCAAGAACCAGCTGGTCACCCGGGAAGGGAATGAGCTCTATCACTGT
GTCATCTACCTGGCCCCTGGGGACTACCACTGCTTCCACTCCCCCACCGACTGGACTGTG
TCCCACCGGCGCCACTTCCCAGGCTCCCTGATGTCAGTGAACCCTGGCATGGCTCGCTGG
ATCAAAGAGCTCTTCTGCCATAACGAGCGGGTGGTCCTGACGGGGGACTGGAAACATGGC
TTCTTCTCACTGACAGCTGTGGGGGCCACCAACGTGGGCTCCATTCGCATCTACTTTGAC
CGGGACCTGCACACAAACAGCCCAAGGCACAGCAAGGGCTCCTACAATGACTTCAGCTTC
GTGACGCACACCAATAGAGAGGGCGTCCCCATGCGTAAGGGCGAGCACCTGGGCGAGTTC
AACCTGGGCTCCACCATCGTGCTCATCTTCGAGGCCCCCAAGGACTTCAATTTCCAGCTG
AAAACAGGACAGAAAATCCGCTTTGGGGAAGCCCTGGGCTCGCTCTAG
Protein Properties
Number of Residues 408
Molecular Weight 43046.33
Theoretical pI 9.703
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Phosphatidylserine decarboxylase proenzyme
MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPART
MFLLRPLPILLVTGGGYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLS
RAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV
CGLHSISPSDGRILNFGQVKNCEVEQVKGVTYSLESFLGPRMCTEDLPFPPAASCDSFKN
QLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKELFCH
NERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNRE
GVPMRKGEHLGEFNLGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL
GenBank ID Protein 13489112
UniProtKB/Swiss-Prot ID Q9UG56
UniProtKB/Swiss-Prot Entry Name PISD_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014338
GeneCard ID PISD
GenAtlas ID PISD
HGNC ID HGNC:8999
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]