You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02385
Secondary Accession Numbers
  • 7876
Name Prostaglandin E2 receptor EP1 subtype
Synonyms
  1. PGE receptor EP1 subtype
  2. PGE2 receptor EP1 subtype
  3. Prostanoid EP1 receptor
Gene Name PTGER1
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(q) proteins which activate a phosphatidylinositol-calcium second messenger system. May play a role as an important modulator of renal function. Implicated the smooth muscle contractile response to PGE2 in various tissues
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
prostaglandin e receptor activity
icosanoid receptor activity
prostanoid receptor activity
prostaglandin receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.1
SNPs PTGER1
Gene Sequence
>1209 bp
ATGAGCCCTTGCGGGCCCCTCAACCTGAGCCTGGCGGGCGAGGCGACCACATGCGCGGCG
CCCTGGGTCCCCAACACGTCGGCCGTGCCGCCGTCGGGCGCTTCGCCCGCGCTGCCCATC
TTCTCCATGACGCTGGGCGCCGTGTCCAACCTGCTGGCGCTGGCGCTGCTGGCGCAGGCC
GCGGGCCGCCTGCGACGCCGCCGCTCGGCCACCACCTTCCTGCTGTTCGTGGCCAGCCTG
CTGGCCACCGACCTGGCGGGCCACGTGATCCCGGGCGCGCTGGTGCTGCGTCTGTACACT
GCGGGGCGCGCTCCGGCCGGCGGGGCCTGCCACTTCCTGGGCGGCTGCATGGTCTTCTTC
GGCCTGTGCCCGCTGCTGCTGGGCTGTGGCATGGCCGTGGAGCGCTGCGTGGGCGTCACG
CGGCCGCTGCTCCACGCCGCGCGGGTCTCGGTCGCCCGCGCGCGCCTGGCGCTGGCCGCG
GTGGCCGCGGTGGCCTTGGCCGTGGCGCTGCTGCCGCTGGCGCGCGTGGGCCGCTATGAG
CTGCAGTACCCGGGCACGTGGTGCTTCATCGGCCTGGGTCCCCCGGGCGGCTGGCGCCAG
GCACTGCTTGCTGGCCTCTTCGCCAGCCTCGGCCTGGTCGCGCTCCTCGCCGCGCTGGTG
TGCAACACGCTCAGCGGCCTGGCCCTGCTACGCGCCCGCTGGCGACGCCGCTCCCGACGG
CCTCCCCCGGCCTCAGGCCCCGACAGCCGGCGTCGCTGGGGGGCGCACGGACCCCGCTCG
GCCTCCGCCTCGTCCGCCTCGTCCATCGCTTCGGCCTCCACCTTCTTTGGCGGCTCTCGG
AGCAGCGGCTCGGCACGCAGAGCTCGCGCCCACGACGTGGAGATGGTGGGCCAGCTTGTC
GGTATCATGGTGGTGTCGTGCATCTGCTGGAGCCCAATGCTGGTGTTGGTGGCGCTGGCC
GTCGGCGGCTGGAGCTCTACCTCCCTGCAGCGGCCACTGTTCCTGGCCGTGCGCCTTGCC
TCCTGGAACCAGATCCTGGACCCTTGGGTGTACATCCTACTGCGCCAGGCCGTGCTGCGC
CAACTGCTTCGCCTCTTGCCCCCGAGGGCCGGAGCCAAGGGCGGCCCCGCGGGGCTGGGC
CTAACACCGAGCGCCTGGGAGGCCAGCTCGCTGCGCAGCTCCCGGCACAGCGGCCTCAGC
CACTTCTAA
Protein Properties
Number of Residues 402
Molecular Weight 41800.7
Theoretical pI 12.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 36-62
  • 73-96
  • 112-133
  • 156-177
  • 202-227
  • 295-321
  • 333-354
Protein Sequence
>Prostaglandin E2 receptor EP1 subtype
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
GenBank ID Protein 30526194
UniProtKB/Swiss-Prot ID P34995
UniProtKB/Swiss-Prot Entry Name PE2R1_HUMAN
PDB IDs Not Available
GenBank Gene ID AY275470
GeneCard ID PTGER1
GenAtlas ID PTGER1
HGNC ID HGNC:9593
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Funk CD, Furci L, FitzGerald GA, Grygorczyk R, Rochette C, Bayne MA, Abramovitz M, Adam M, Metters KM: Cloning and expression of a cDNA for the human prostaglandin E receptor EP1 subtype. J Biol Chem. 1993 Dec 15;268(35):26767-72. [PubMed:8253813 ]