Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02407
Secondary Accession Numbers
  • 7900
Name Neurocan core protein
Synonyms
  1. Chondroitin sulfate proteoglycan 3
Gene Name NCAN
Protein Type Enzyme
Biological Properties
General Function Involved in sugar binding
Specific Function May modulate neuronal adhesion and neurite growth during development by binding to neural cell adhesion molecules (NG-CAM and N-CAM). Chondroitin sulfate proteoglycan; binds to hyaluronic acid
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
pattern binding
polysaccharide binding
glycosaminoglycan binding
hyaluronic acid binding
calcium ion binding
carbohydrate binding
sugar binding
Process
cell adhesion
cellular process
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 19p12
SNPs NCAN
Gene Sequence
>3966 bp
ATGGGGGCCCCGTTTGTCTGGGCCTTGGGCCTTTTGATGCTGCAGATGCTGCTCTTTGTG
GCTGGGGAACAGGGCACACAGGATATCACCGATGCCAGCGAAAGGGGGCTCCACATGCAG
AAGCTGGGGTCTGGGTCAGTGCAGGCTGCGCTGGCGGAGCTGGTGGCCCTGCCCTGTCTC
TTTACCCTGCAGCCACGGCCAAGCGCAGCCCGAGATGCCCCTCGGATAAAGTGGACCAAG
GTGCGGACTGCGTCGGGCCAGCGACAGGACTTGCCCATCCTGGTGGCCAAGGACAATGTC
GTGAGGGTGGCCAAAAGCTGGCAGGGACGAGTGTCACTGCCTTCCTACCCCCGGCGCCGA
GCCAACGCCACGCTACTTCTGGGGCCACTGAGGGCCAGTGACTCTGGGCTGTACCGCTGC
CAGGTGGTGAGGGGCATCGAGGATGAGCAGGACCTGGTGCCCTTGGAGGTGACAGGTGTT
GTGTTCCACTACCGATCAGCCCGGGACCGCTATGCACTGACCTTCGCTGAGGCCCAGGAG
GCCTGCCGTCTCAGCTCAGCCATCATTGCAGCCCCTCGGCATCTACAGGCTGCCTTTGAG
GATGGCTTTGACAACTGTGATGCTGGCTGGCTCTCTGACCGCACTGTTCGGTATCCTATC
ACCCAGTCCCGTCCTGGTTGCTATGGCGACCGTAGCAGCCTTCCAGGGGTTCGGAGCTAT
GGGAGGCGCAACCCACAGGAACTCTACGATGTGTATTGCTTTGCCCGGGAGCTGGGGGGC
GAGGTCTTCTACGTGGGCCCGGCCCGCCGCCTGACACTGGCCGGCGCGCGTGCACAGTGC
CGCCGCCAGGGTGCCGCGCTGGCCTCGGTGGGACAGCTGCACCTGGCCTGGCATGAGGGC
CTGGACCAGTGCGACCCGGGCTGGCTGGCCGACGGCAGCGTGCGCTACCCGATCCAGACG
CCGCGCCGGCGCTGCGGGGGCCCAGCCCCGGGCGTGCGCACCGTCTACCGCTTCGCTAAC
CGGACCGGCTTCCCCTCACCCGCCGAGCGCTTCGACGCCTACTGCTTCCGAGCTCATCAC
CCCACGTCACAACATGGAGACCTAGAGACCCCATCCTCTGGGGATGAGGGGGAGATTCTG
TCAGCAGAGGGGCCCCCAGTTAGAGAACTGGAGCCCACCCTGGAGGAGGAAGAGGTGGTC
ACCCCTGACTTCCAGGAGCCTCTGGTGTCCAGTGGGGAAGAAGAAACCCTGATTTTGGAG
GAGAAGCAGGAGTCTCAACAGACCCTCAGCCCTACCCCTGGGGACCCCATGCTGGCCTCA
TGGCCCACTGGGGAAGTGTGGCTAAGCACGGTGGCCCCCAGCCCTAGCGACATGGGGGCA
GGCACTGCAGCAAGTTCACACACGGAGGTGGCCCCAACTGACCCTATGCCTAGGAGAAGG
GGGCGCTTCAAAGGGTTGAATGGGCGCTACTTCCAGCAGCAGGAACCGGAGCCGGGGCTG
CAAGGGGGGATGGAGGCCAGCGCCCAGCCCCCCACCTCAGAGGCTGCAGTGAACCAAATG
GAGCCTCCGTTGGCCATGGCAGTCACAGAGATGTTGGGCAGTGGCCAGAGCCGGAGCCCC
TGGGCTGATCTGACCAATGAGGTGGATATGCCTGGAGCTGGTTCTGCTGGTGGCAAGAGC
TCCCCAGAGCCCTGGCTGTGGCCCCCTACCATGGTCCCACCCAGCATCTCAGGCCACAGC
AGGGCCCCTGTCCTGGAGCTAGAGAAAGCCGAGGGCCCCAGTGCCAGGCCAGCCACCCCA
GACCTGTTTTGGTCCCCCTTGGAGGCCACTGTCTCAGCTCCCAGCCCTGCCCCCTGGGAG
GCATTCCCTGTGGCCACCTCCCCAGATCTCCCTATGATGGCCATGCTGCGTGGTCCCAAA
GAGTGGATGCTACCACACCCCACCCCCATCTCCACCGAGGCCAATAGAGTTGAGGCACAT
GGTGAGGCCACCGCCACGGCTCCACCCTCCCCTGCTGCAGAGACCAAGGTGTATTCCCTG
CCTCTCTCTTTGACCCCAACAGGACAGGGTGGAGAGGCCATGCCCACAACACCTGAGTCC
CCCAGGGCAGACTTCAGAGAAACTGGGGAGACCAGCCCTGCTCAGGTCAACAAAGCTGAG
CACTCCAGCTCCAGCCCATGGCCTTCTGTAAACAGGAATGTGGCTGTAGGTTTTGTCCCC
ACTGAGACTGCCACTGAGCCAACGGGCCTCAGGGGTATCCCGGGGTCTGAGTCTGGGGTC
TTCGACACAGCAGAAAGCCCCACTTCTGGCTTGCAGGCCACTGTAGATGAGGTGCAGGAC
CCCTGGCCCTCAGTGTACAGCAAAGGGCTGGATGCAAGTTCCCCATCTGCCCCCCTGGGG
AGCCCTGGAGTCTTCTTGGTACCCAAAGTCACCCCAAATTTGGAGCCTTGGGTTGCTACA
GATGAAGGACCCACTGTGAATCCCATGGATTCCACAGTCACGCCGGCCCCCAGTGATGCT
AGTGGAATTTGGGAACCTGGATCCCAGGTGTTTGAAGAAGCCGAAAGCACCACCTTGAGC
CCTCAGGTGGCCCTGGATACAAGCATTGTGACGCCCCTCACGACCCTGGAGCAGGGGGAC
AAGGTTGGAGTTCCAGCCATGTCTACACTGGGCTCCTCAAGCTCCCAACCCCACCCAGAG
CCAGAGGATCAGGTGGAGACCCAGGGAACATCAGGAGCTTCAGTGCCTCCGCATCAGAGC
AGTCCCCTAGGGAAACCGGCTGTTCCTCCTGGGACACCGACTGCAGCCAGTGTGGGCGAG
TCTGCCTCAGTTTCCTCAGGGGAGCCTACGGTACCGTGGGACCCCTCCAGCACCCTGCTG
CCTGTCACCCTGGGCATAGAGGACTTCGAACTGGAGGTCCTGGCAGGGAGCCCGGGTGTA
GAGAGCTTCTGGGAGGAGGTGGCAAGTGGAGAGGAGCCAGCCCTGCCAGGGACCCCTATG
AATGCAGGTGCGGAGGAGGTGCACTCAGATCCCTGTGAGAACAACCCTTGTCTTCATGGA
GGGACATGTAATGCCAATGGCACCATGTATGGCTGTAGCTGTGATCAGGGCTTCGCCGGG
GAGAACTGTGAGATTGACATTGATGACTGCCTCTGCAGCCCCTGTGAGAATGGAGGCACC
TGTATTGATGAGGTCAATGGCTTTGTCTGCCTTTGCCTCCCCAGCTATGGGGGCAGCTTT
TGTGAGAAAGACACCGAGGGCTGTGACCGCGGCTGGCATAAGTTCCAGGGCCACTGTTAC
CGCTATTTTGCCCACCGGAGGGCATGGGAAGATGCCGAGAAGGACTGCCGCCGCCGCTCC
GGCCACCTGACCAGCGTCCACTCACCGGAGGAACACAGCTTCATTAATAGCTTTGGGCAT
GAAAACACGTGGATCGGCCTGAACGACAGGATCGTGGAGAGAGATTTCCAGTGGACGGAC
AACACCGGGCTGCAATTTGAGAACTGGCGAGAGAACCAGCCGGACAATTTCTTCGCGGGT
GGCGAGGACTGTGTGGTGATGGTGGCGCATGAAAGCGGGCGCTGGAACGATGTCCCCTGC
AACTACAACCTACCCTATGTCTGCAAGAAGGGCACAGTGCTCTGTGGTCCCCCTCCGGCA
GTGGAGAATGCCTCACTCATCGGTGCCCGCAAGGCCAAGTACAATGTCCATGCCACTGTA
AGGTACCAGTGCAATGAAGGATTTGCCCAGCACCATGTGGCCACCATTCGATGCCGGAGC
AATGGCAAGTGGGACAGGCCCCAAATTGTCTGCACCAAACCCAGACGTTCACATCGGATG
CGGCGACACCACCACCACCACCAACACCACCACCAGCATCACCACCACAAATCCCGCAAG
GAGCGCAGAAAACACAAGAAACACCCAACGGAGGACTGGGAGAAGGACGAAGGGAATTTC
TGCTGA
Protein Properties
Number of Residues 1321
Molecular Weight 143092.1
Theoretical pI 5.06
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • None
Protein Sequence
>Neurocan core protein
MGAPFVWALGLLMLQMLLFVAGEQGTQDITDASERGLHMQKLGSGSVQAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRR
ANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQE
ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHH
PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEETLILE
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPMPRRR
GRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSP
WADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATP
DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAH
GEATATAPPSPAAETKVYSLPLSLTPTGQGGEAMPTTPESPRADFRETGETSPAQVNKAE
HSSSSPWPSVNRNVAVGFVPTETATEPTGLRGIPGSESGVFDTAESPTSGLQATVDEVQD
PWPSVYSKGLDASSPSAPLGSPGVFLVPKVTPNLEPWVATDEGPTVNPMDSTVTPAPSDA
SGIWEPGSQVFEEAESTTLSPQVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQPHPE
PEDQVETQGTSGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLL
PVTLGIEDFELEVLAGSPGVESFWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHG
GTCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSF
CEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRSGHLTSVHSPEEHSFINSFGH
ENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPC
NYNLPYVCKKGTVLCGPPPAVENASLIGARKAKYNVHATVRYQCNEGFAQHHVATIRCRS
NGKWDRPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPTEDWEKDEGNF
C
GenBank ID Protein 118600983
UniProtKB/Swiss-Prot ID O14594
UniProtKB/Swiss-Prot Entry Name NCAN_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004386.2
GeneCard ID NCAN
GenAtlas ID NCAN
HGNC ID HGNC:2465
References
General References
  1. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  2. Prange CK, Pennacchio LA, Lieuallen K, Fan W, Lennon GG: Characterization of the human neurocan gene, CSPG3. Gene. 1998 Oct 23;221(2):199-205. [PubMed:9795216 ]