You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02475
Secondary Accession Numbers
  • 7970
Name Leucyl-cystinyl aminopeptidase
Synonyms
  1. Cystinyl aminopeptidase
  2. IRAP
  3. Insulin-regulated membrane aminopeptidase
  4. Insulin-responsive aminopeptidase
  5. Leucyl-cystinyl aminopeptidase, pregnancy serum form
  6. OTase
  7. Oxytocinase
  8. P-LAP
  9. Placental leucine aminopeptidase
Gene Name LNPEP
Protein Type Unknown
Biological Properties
General Function Involved in proteolysis
Specific Function Release of an N-terminal amino acid, cleaves before cysteine, leucine as well as other amino acids. Degrades peptide hormones such as oxytocin, vasopressin and angiotensin III, and plays a role in maintaining homeostasis during pregnancy. May be involved in the inactivation of neuronal peptides in the brain. Cleaves Met-enkephalin and dynorphin. Binds angiotensin IV and may be the angiotensin IV receptor in the brain
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
peptidase activity
peptidase activity, acting on l-amino acid peptides
metallopeptidase activity
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Leucyl-cystinyl aminopeptidase
  2. pregnancy serum form:Secreted
Gene Properties
Chromosome Location Chromosome:5
Locus 5q15
SNPs LNPEP
Gene Sequence
>3078 bp
ATGGAGCCCTTCACCAATGATCGGCTTCAGCTCCCCAGGAATATGATTGAAAACAGCATG
TTTGAGGAAGAACCAGATGTGGTGGATTTAGCCAAAGAGCCTTGTTTACATCCTCTAGAG
CCTGATGAGGTGGAATATGAGCCCCGGGGTTCCCGACTGCTGGTGCGGGGTCTTGGTGAG
CATGAGATGGAGGAGGATGAAGAGGATTATGAGTCATCAGCAAAGCTGCTGGGCATGTCC
TTCATGAATAGAAGCTCAGGCCTTCGGAACAGTGCAACTGGTTACAGGCAGAGCCCAGAT
GGGGCTTGTTCAGTACCCTCTGCAAGGACCATGGTGGTCTGTGCTTTTGTCATCGTGGTT
GCTGTTTCTGTAATCATGGTGATTTACTTACTGCCCAGATGTACCTTTACCAAAGAAGGC
TGCCATAAAAAAAACCAGTCAATTGGACTAATTCAGCCATTTGCAACAAATGGGAAATTG
TTTCCATGGGCACAGATCAGGCTTCCCACTGCCGTTGTGCCACTACGCTATGAACTCAGC
CTACACCCGAACCTAACCTCGATGACATTCAGGGGTTCTGTGACAATTTCAGTTCAGGCT
CTTCAGGTCACATGGAATATCATTCTTCATAGCACAGGTCATAATATTTCAAGAGTGACC
TTTATGTCAGCAGTTTCAAGCCAAGAAAAACAAGCTGAGATCCTGGAATATGCATATCAT
GGACAGATCGCCATTGTTGCCCCCGAAGCCCTTCTAGCAGGGCACAATTATACGTTGAAG
ATAGAGTACTCGGCAAATATATCTAGTTCTTATTATGGGTTTTATGGCTTCTCCTACACA
GATGAAAGTAATGAGAAAAAGTACTTTGCAGCAACTCAGTTTGAACCCCTGGCAGCAAGA
TCTGCTTTTCCTTGTTTTGATGAACCAGCATTTAAAGCCACTTTTATCATCAAGATCATA
AGGGATGAGCAATACACCGCTTTATCAAATATGCCTAAGAAGTCATCAGTCGTTCTAGAT
GATGGACTTGTTCAGGATGAGTTTTCTGAGAGTGTGAAGATGAGCACTTACTTGGTTGCT
TTCATTGTGGGAGAGATGAAGAACCTGAGTCAGGACGTAAATGGAACCCTGGTTTCTATA
TATGCTGTACCAGAAAAGATTGGTCAAGTTCATTATGCCTTGGAAACAACTGTGAAGCTT
CTTGAGTTTTTTCAAAACTACTTTGAAATTCAGTACCCACTTAAGAAATTGGATTTGGTG
GCTATTCCTGACTTTGAAGCAGGAGCAATGGAAAATTGGGGTTTGCTCACCTTCCGAGAG
GAGACACTTCTGTATGACAGTAACACTTCTTCAATGGCGGATAGAAAGCTGGTGACTAAA
ATCATTGCTCATGAGCTGGCCCACCAGTGGTTTGGCAATCTGGTAACAATGAAGTGGTGG
AATGACCTATGGCTAAATGAAGGTTTTGCCACTTTCATGGAGTATTTCTCTTTGGAAAAA
ATATTCAAAGAGCTTTCTAGTTATGAAGATTTCTTAGATGCTCGATTTAAAACCATGAAG
AAAGATTCCTTAAATTCATCTCATCCAATATCATCATCTGTTCAGTCTTCAGAACAAATT
GAAGAAATGTTTGATTCTCTTTCCTATTTTAAGGGATCTTCTCTCTTGTTGATGTTGAAA
ACTTACCTTAGTGAAGATGTGTTTCAACATGCTGTTGTCCTTTACCTGCATAATCACAGC
TATGCATCTATTCAAAGTGATGATCTGTGGGATAGTTTTAATGAGGTCACAAACCAAACA
CTAGATGTAAAGAGAATGATGAAAACCTGGACCCTGCAGAAAGGATTTCCTTTAGTGACT
GTTCAAAAGAAAGGAAAGGAACTTTTTATACAACAAGAGAGATTCTTTTTAAATATGAAG
CCTGAAATTCAGCCTTCAGATACAAGCTACCTGTGGCATATTCCACTATCCTATGTCACT
GAAGGAAGAAATTATTCAAAATATCAATCGGTATCATTACTGGATAAGAAATCAGGTGTC
ATCAATCTTACAGAAGAAGTGCTGTGGGTCAAAGTGAATATAAACATGAATGGTTATTAT
ATTGTACACTATGCAGATGATGATTGGGAAGCACTAATCCATCAGTTGAAAATAAATCCT
TATGTTCTGAGTGACAAAGACCGAGCCAACCTTATCAACAACATCTTTGAACTTGCAGGC
CTAGGCAAGGTACCTCTCAAGAGGGCCTTTGATTTGATTAATTATCTTGGAAATGAGAAC
CATACTGCACCCATCACCGAAGCCCTGTTTCAGACAGACCTCATCTATAACCTCCTTGAA
AAACTGGGATACATGGATCTGGCCTCAAGACTGGTGACTAGGGTATTTAAATTACTTCAA
AACCAAATTCAACAACAAACTTGGACTGATGAGGGCACTCCATCTATGCGAGAGCTTCGG
TCAGCCCTGCTAGAGTTTGCTTGCACCCACAACCTGGGGAACTGCTCTACTACTGCCATG
AAACTGTTTGATGACTGGATGGCATCCAATGGAACTCAAAGCCTACCTACTGATGTCATG
ACAACTGTGTTCAAAGTTGGAGCAAAAACTGACAAAGGCTGGTCATTCCTTTTGGGCAAA
TACATTTCTATAGGCTCTGAAGCAGAGAAGAACAAAATACTAGAAGCACTTGCCAGCTCA
GAGGATGTGCGGAAGCTTTACTGGTTAATGAAAAGTAGCCTGAATGGAGATAACTTCCGA
ACACAGAAGCTGTCTTTTATCATTAGAACAGTGGGTCGACATTTTCCTGGACACTTACTG
GCATGGGATTTTGTCAAAGAGAACTGGAATAAGCTTGTACAGAAGTTCCCTCTGGGGTCC
TATACCATACAAAATATTGTTGCTGGATCAACTTACCTGTTTTCAACAAAGACACATTTA
TCTGAGGTTCAGGCATTCTTTGAAAATCAGTCAGAGGCAACCTTCCGGCTTCGTTGTGTC
CAGGAGGCTTTGGAAGTCATTCAGTTGAATATCCAGTGGATGGAGAAGAACCTCAAAAGT
CTCACATGGTGGCTGTAG
Protein Properties
Number of Residues 1025
Molecular Weight 117348.1
Theoretical pI 5.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 111-131
Protein Sequence
>Leucyl-cystinyl aminopeptidase
MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
HEMEEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVV
AVSVIMVIYLLPRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELS
LHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYH
GQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAAR
SAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVA
FIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV
AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWW
NDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQI
EEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQT
LDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVT
EGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINP
YVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLE
KLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM
KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASS
EDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGS
YTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKS
LTWWL
GenBank ID Protein 61742777
UniProtKB/Swiss-Prot ID Q9UIQ6
UniProtKB/Swiss-Prot Entry Name LCAP_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005575.2
GeneCard ID LNPEP
GenAtlas ID LNPEP
HGNC ID HGNC:6656
References
General References
  1. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM: Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks. Proc Natl Acad Sci U S A. 2007 Apr 3;104(14):5860-5. Epub 2007 Mar 26. [PubMed:17389395 ]
  4. Rogi T, Tsujimoto M, Nakazato H, Mizutani S, Tomoda Y: Human placental leucine aminopeptidase/oxytocinase. A new member of type II membrane-spanning zinc metallopeptidase family. J Biol Chem. 1996 Jan 5;271(1):56-61. [PubMed:8550619 ]
  5. Laustsen PG, Rasmussen TE, Petersen K, Pedraza-Diaz S, Moestrup SK, Gliemann J, Sottrup-Jensen L, Kristensen T: The complete amino acid sequence of human placental oxytocinase. Biochim Biophys Acta. 1997 May 2;1352(1):1-7. [PubMed:9177475 ]
  6. Rasmussen TE, Pedraza-Diaz S, Hardre R, Laustsen PG, Carrion AG, Kristensen T: Structure of the human oxytocinase/insulin-regulated aminopeptidase gene and localization to chromosome 5q21. Eur J Biochem. 2000 Apr;267(8):2297-306. [PubMed:10759854 ]
  7. Matsumoto H, Nagasaka T, Hattori A, Rogi T, Tsuruoka N, Mizutani S, Tsujimoto M: Expression of placental leucine aminopeptidase/oxytocinase in neuronal cells and its action on neuronal peptides. Eur J Biochem. 2001 Jun;268(11):3259-66. [PubMed:11389728 ]
  8. Falk K, Rotzschke O, Stevanovic S, Jung G, Rammensee HG: Pool sequencing of natural HLA-DR, DQ, and DP ligands reveals detailed peptide motifs, constraints of processing, and general rules. Immunogenetics. 1994;39(4):230-42. [PubMed:8119729 ]
  9. Tsujimoto M, Mizutani S, Adachi H, Kimura M, Nakazato H, Tomoda Y: Identification of human placental leucine aminopeptidase as oxytocinase. Arch Biochem Biophys. 1992 Feb 1;292(2):388-92. [PubMed:1731608 ]
  10. Albiston AL, McDowall SG, Matsacos D, Sim P, Clune E, Mustafa T, Lee J, Mendelsohn FA, Simpson RJ, Connolly LM, Chai SY: Evidence that the angiotensin IV (AT(4)) receptor is the enzyme insulin-regulated aminopeptidase. J Biol Chem. 2001 Dec 28;276(52):48623-6. Epub 2001 Nov 13. [PubMed:11707427 ]