You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02759
Secondary Accession Numbers
  • 8264
Name Prostaglandin D2 receptor
Synonyms
  1. PGD receptor
  2. PGD2 receptor
  3. Prostanoid DP receptor
Gene Name PTGDR
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for prostaglandin D2 (PGD2). The activity of this receptor is mainly mediated by G(s) proteins that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP. A mobilization of calcium is also observed, but without formation of inositol 1,4,5-trisphosphate
Pathways
  • Intracellular Signalling Through PGD2 receptor and Prostaglandin D2
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
transmembrane receptor activity
prostaglandin d receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
icosanoid receptor activity
prostanoid receptor activity
prostaglandin receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 14q22.1
SNPs PTGDR
Gene Sequence
>1080 bp
ATGAAGTCGCCGTTCTACCGCTGCCAGAACACCACCTCTGTGGAAAAAGGCAACTCGGCG
GTGATGGGCGGGGTGCTCTTCAGCACCGGCCTCCTGGGCAACCTGCTGGCCCTGGGGCTG
CTGGCGCGCTCGGGGCTGGGGTGGTGCTCGCGGCGTCCACTGCGCCCGCTGCCCTCGGTC
TTCTACATGCTGGTGTGTGGCCTGACGGTCACCGACTTGCTGGGCAAGTGCCTCCTAAGC
CCGGTGGTGCTGGCTGCCTACGCTCAGAACCGGAGTCTGCGGGTGCTTGCGCCCGCATTG
GACAACTCGTTGTGCCAAGCCTTCGCCTTCTTCATGTCCTTCTTTGGGCTCTCCTCGACA
CTGCAACTCCTGGCCATGGCACTGGAGTGCTGGCTCTCCCTAGGGCACCCTTTCTTCTAC
CGACGGCACATCACCCTGCGCCTGGGCGCACTGGTGGCCCCGGTGGTGAGCGCCTTCTCC
CTGGCTTTCTGCGCGCTACCTTTCATGGGCTTCGGGAAGTTCGTGCAGTACTGCCCCGGC
ACCTGGTGCTTTATCCAGATGGTCCACGAGGAGGGCTCGCTGTCGGTGCTGGGGTACTCT
GTGCTCTACTCCAGCCTCATGGCGCTGCTGGTCCTCGCCACCGTGCTGTGCAACCTCGGC
GCCATGCGCAACCTCTATGCGATGCACCGGCGGCTGCAGCGGCACCCGCGCTCCTGCACC
AGGGACTGTGCCGAGCCGCGCGCGGACGGGAGGGAAGCGTCCCCTCAGCCCCTGGAGGAG
CTGGATCACCTCCTGCTGCTGGCGCTGATGACCGTGCTCTTCACTATGTGTTCTCTGCCC
GTAATTTATCGCGCTTACTATGGAGCATTTAAGGATGTCAAGGAGAAAAACAGGACCTCT
GAAGAAGCAGAAGACCTCCGAGCCTTGCGATTTCTATCTGTGATTTCAATTGTGGACCCT
TGGATTTTTATCATTTTCAGATCTCCAGTATTTCGGATATTTTTTCACAAGATTTTCATT
AGACCTCTTAGGTACAGGAGCCGGTGCAGCAATTCCACTAACATGGAATCCAGTCTGTGA
Protein Properties
Number of Residues 359
Molecular Weight 40270.1
Theoretical pI 9.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 22-42
  • 60-80
  • 108-128
  • 151-171
  • 196-216
  • 263-283
  • 311-331
Protein Sequence
>Prostaglandin D2 receptor
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
GenBank ID Protein 28466969
UniProtKB/Swiss-Prot ID Q13258
UniProtKB/Swiss-Prot Entry Name PD2R_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_000953.2
GeneCard ID PTGDR
GenAtlas ID PTGDR
HGNC ID HGNC:9591
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Boie Y, Sawyer N, Slipetz DM, Metters KM, Abramovitz M: Molecular cloning and characterization of the human prostanoid DP receptor. J Biol Chem. 1995 Aug 11;270(32):18910-6. [PubMed:7642548 ]
  3. Town MH, Casals-Stenzel J, Schillinger E: Pharmacological and cardiovascular properties of a hydantoin derivative, BW 245 C, with high affinity and selectivity for PGD2 receptors. Prostaglandins. 1983 Jan;25(1):13-28. [PubMed:6302737 ]
  4. Sharif NA, Williams GW, Davis TL: Pharmacology and autoradiography of human DP prostanoid receptors using [(3)H]-BWA868C, a DP receptor-selective antagonist radioligand. Br J Pharmacol. 2000 Nov;131(6):1025-38. [PubMed:11082108 ]
  5. Oguma T, Palmer LJ, Birben E, Sonna LA, Asano K, Lilly CM: Role of prostanoid DP receptor variants in susceptibility to asthma. N Engl J Med. 2004 Oct 21;351(17):1752-63. [PubMed:15496624 ]