You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02805
Secondary Accession Numbers
  • 8311
Name Sulfate transporter
Synonyms
  1. Diastrophic dysplasia protein
  2. Solute carrier family 26 member 2
Gene Name SLC26A2
Protein Type Enzyme
Biological Properties
General Function Inorganic ion transport and metabolism
Specific Function Sulfate transporter. May play a role in endochondral bone formation.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
sulfate transport
ossification
Cellular Component
integral to plasma membrane
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
inorganic anion transmembrane transporter activity
sulfate transmembrane transporter activity
secondary active sulfate transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
anion transmembrane transporter activity
Molecular Function
secondary active sulfate transmembrane transporter activity
sulfate transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
anion transport
inorganic anion transport
sulfate transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 5
Locus 5q31-q34
SNPs SLC26A2
Gene Sequence
>2220 bp
ATGTCTTCAGAAAGTAAAGAGCAACATAACGTTTCACCCAGAGACTCAGCTGAAGGAAAT
GACAGTTATCCATCTGGGATCCATCTGGAACTTCAAAGGGAATCAAGTACTGACTTCAAG
CAATTTGAGACCAATGATCAATGCAGACCTTATCATAGGATCCTTATTGAGCGTCAAGAG
AAATCAGATACAAACTTCAAGGAGTTTGTTATTAAAAAGCTGCAGAAGAATTGCCAGTGC
AGTCCAGCCAAAGCCAAAAATATGATTTTAGGTTTCCTTCCTGTTTTGCAGTGGCTCCCA
AAATACGACCTAAAGAAAAACATTTTAGGGGATGTGATGTCAGGCTTGATTGTGGGCATA
TTATTGGTGCCCCAGTCCATTGCTTATTCCCTGCTGGCTGGCCAAGAACCTGTCTATGGT
CTGTACACATCTTTTTTTGCCAGCATCATTTATTTTCTCTTGGGTACCTCCCGTCACATC
TCTGTGGGCATTTTTGGAGTACTGTGCCTTATGATTGGTGAGACAGTTGACCGAGAACTA
CAGAAAGCTGGCTATGACAATGCCCATAGTGCTCCTTCCTTAGGAATGGTTTCAAATGGG
AGCACATTATTAAATCATACATCAGACAGGATATGTGACAAAAGTTGCTATGCAATTATG
GTTGGCAGCACTGTAACCTTTATAGCTGGAGTTTATCAGGTAGCGATGGGCTTCTTTCAA
GTGGGTTTTGTTTCTGTCTACCTCTCAGATGCCTTGCTGAGTGGATTTGTCACTGGTGCC
TCCTTCACTATTCTTACATCTCAGGCCAAGTATCTTCTTGGGCTCAACCTTCCTCGGACT
AATGGTGTGGGCTCACTCATCACTACCTGGATACATGTCTTCAGAAACATCCATAAGACC
AATCTCTGTGATCTTATCACCAGCCTTTTGTGCCTTTTGGTTCTTTTGCCAACCAAAGAA
CTCAATGAACACTTCAAATCCAAGCTTAAGGCACCGATTCCTATTGAACTTGTTGTTGTT
GTAGCAGCCACATTAGCCTCTCATTTTGGAAAACTACATGAAAATTATAATTCTAGTATT
GCTGGACATATTCCCACTGGGTTTATGCCACCCAAAGTACCAGAATGGAACCTAATTCCT
AGTGTGGCTGTAGATGCAATAGCTATTTCCATCATTGGTTTTGCTATCACTGTATCACTT
TCTGAGATGTTTGCCAAGAAACATGGTTACACAGTCAAAGCAAACCAGGAAATGTATGCC
ATTGGCTTTTGTAATATCATCCCTTCCTTCTTCCACTGTTTTACTACTAGTGCAGCTCTT
GCAAAGACATTGGTTAAAGAATCAACAGGCTGCCATACTCAGCTTTCTGGTGTGGTAACA
GCCCTGGTTCTTTTGTTGGTCCTCCTAGTAATAGCTCCTTTGTTCTATTCCCTTCAAAAA
AGTGTCCTTGGTGTGATCACAATTGTAAATCTACGGGGAGCCCTTCGTAAATTTAGGGAT
CTTCCCAAAATGTGGAGTATTAGTAGAATGGATACAGTTATCTGGTTTGTTACTATGCTG
TCCTCTGCACTGCTAAGTACTGAAATAGGCCTACTTGTTGGGGTTTGTTTTTCTATATTT
TGTGTCATCCTCCGCACTCAGAAGCCAAAGAGTTCACTGCTTGGCTTGGTGGAAGAGTCT
GAGGTCTTTGAATCTGTGTCTGCTTACAAGAACCTTCAGATTAAGCCAGGCATCAAGATT
TTCCGCTTTGTAGCCCCTCTCTACTACATAAACAAAGAATGCTTTAAATCTGCTTTATAC
AAACAAACTGTCAACCCAATCTTAATAAAGGTGGCTTGGAAGAAGGCAGCAAAGAGAAAG
ATCAAAGAAAAAGTAGTGACTCTTGGTGGAATCCAGGATGAAATGTCAGTGCAACTTTCC
CATGATCCCTTGGAGCTGCATACTATAGTGATTGACTGCAGTGCAATTCAATTTTTAGAT
ACAGCAGGGATCCACACACTGAAAGAAGTTCGCAGAGATTATGAAGCCATTGGAATCCAG
GTTCTGCTGGCTCAGTGCAATCCCACTGTGAGGGATTCCCTAACCAACGGAGAATATTGC
AAAAAGGAAGAAGAAAACCTTCTCTTCTATAGTGTGTATGAAGCGATGGCTTTTGCAGAA
GTATCTAAAAATCAGAAAGGAGTATGTGTTCCCAATGGTCTGAGTCTTAGTAGTGATTAA
Protein Properties
Number of Residues 739
Molecular Weight 81660.71
Theoretical pI 8.382
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sulfate transporter
MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQE
KSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDVMSGLIVGI
LLVPQSIAYSLLAGQEPVYGLYTSFFASIIYFLLGTSRHISVGIFGVLCLMIGETVDREL
QKAGYDNAHSAPSLGMVSNGSTLLNHTSDRICDKSCYAIMVGSTVTFIAGVYQVAMGFFQ
VGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLNLPRTNGVGSLITTWIHVFRNIHKT
NLCDLITSLLCLLVLLPTKELNEHFKSKLKAPIPIELVVVVAATLASHFGKLHENYNSSI
AGHIPTGFMPPKVPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYA
IGFCNIIPSFFHCFTTSAALAKTLVKESTGCHTQLSGVVTALVLLLVLLVIAPLFYSLQK
SVLGVITIVNLRGALRKFRDLPKMWSISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSIF
CVILRTQKPKSSLLGLVEESEVFESVSAYKNLQIKPGIKIFRFVAPLYYINKECFKSALY
KQTVNPILIKVAWKKAAKRKIKEKVVTLGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLD
TAGIHTLKEVRRDYEAIGIQVLLAQCNPTVRDSLTNGEYCKKEEENLLFYSVYEAMAFAE
VSKNQKGVCVPNGLSLSSD
GenBank ID Protein 100913030
UniProtKB/Swiss-Prot ID P50443
UniProtKB/Swiss-Prot Entry Name S26A2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_000112.3
GeneCard ID SLC26A2
GenAtlas ID Not Available
HGNC ID HGNC:10994
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  7. Hastbacka J, de la Chapelle A, Mahtani MM, Clines G, Reeve-Daly MP, Daly M, Hamilton BA, Kusumi K, Trivedi B, Weaver A, et al.: The diastrophic dysplasia gene encodes a novel sulfate transporter: positional cloning by fine-structure linkage disequilibrium mapping. Cell. 1994 Sep 23;78(6):1073-87. [PubMed:7923357 ]
  8. Superti-Furga A, Hastbacka J, Wilcox WR, Cohn DH, van der Harten HJ, Rossi A, Blau N, Rimoin DL, Steinmann B, Lander ES, Gitzelmann R: Achondrogenesis type IB is caused by mutations in the diastrophic dysplasia sulphate transporter gene. Nat Genet. 1996 Jan;12(1):100-2. [PubMed:8528239 ]
  9. Hastbacka J, Superti-Furga A, Wilcox WR, Rimoin DL, Cohn DH, Lander ES: Atelosteogenesis type II is caused by mutations in the diastrophic dysplasia sulfate-transporter gene (DTDST): evidence for a phenotypic series involving three chondrodysplasias. Am J Hum Genet. 1996 Feb;58(2):255-62. [PubMed:8571951 ]
  10. Megarbane A, Haddad FA, Haddad-Zebouni S, Achram M, Eich G, Le Merrer M, Superti-Furga A: Homozygosity for a novel DTDST mutation in a child with a 'broad bone-platyspondylic' variant of diastrophic dysplasia. Clin Genet. 1999 Jul;56(1):71-6. [PubMed:10466420 ]
  11. Makitie O, Savarirayan R, Bonafe L, Robertson S, Susic M, Superti-Furga A, Cole WG: Autosomal recessive multiple epiphyseal dysplasia with homozygosity for C653S in the DTDST gene: double-layer patella as a reliable sign. Am J Med Genet A. 2003 Oct 15;122A(3):187-92. [PubMed:12966518 ]