You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02860
Secondary Accession Numbers
  • 8367
Name Sodium/iodide cotransporter
Synonyms
  1. Na(+)/I(-) cotransporter
  2. Na(+)/I(-) symporter
  3. Sodium-iodide symporter
  4. Solute carrier family 5 member 5
Gene Name SLC5A5
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Mediates iodide uptake in the thyroid gland.
Pathways
  • Thyroid hormone synthesis
Reactions Not Available
GO Classification
Biological Process
cellular nitrogen compound metabolic process
cellular response to gonadotropin stimulus
cellular response to cAMP
thyroid hormone generation
Cellular Component
plasma membrane
nucleus
integral to membrane
Component
membrane
cell part
Function
transporter activity
Molecular Function
iodide transmembrane transporter activity
sodium:iodide symporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 19
Locus 19p13.11
SNPs SLC5A5
Gene Sequence
>1932 bp
ATGGAGGCCGTGGAGACCGGGGAACGGCCCACCTTCGGAGCCTGGGACTACGGGGTCTTT
GCCCTCATGCTCCTGGTGTCCACTGGCATCGGGCTGTGGGTCGGGCTGGCTCGGGGCGGG
CAGCGCAGCGCTGAGGACTTCTTCACCGGGGGCCGGCGCCTGGCGGCCCTGCCCGTGGGC
CTGTCGCTGTCTGCCAGCTTCATGTCGGCCGTGCAGGTGCTGGGCGTGCCGTCGGAGGCC
TATCGCTATGGCCTCAAGTTCCTCTGGATGTGCCTGGGCCAGCTTCTGAACTCGGTCCTC
ACCGCCCTGCTCTTCATGCCCGTCTTCTACCGCCTGGGCCTCACCAGCACCTACGAGTAC
CTGGAGATGCGCTTCAGCCGCGCAGTGCGGCTCTGCGGGACTTTGCAGTACATTGTAGCC
ACGATGCTGTACACCGGCATCGTAATCTACGCACCGGCCCTCATCCTGAACCAAGTGACC
GGGCTGGACATCTGGGCGTCGCTCCTGTCCACCGGAATTATCTGCACCTTCTACACGGCT
GTGGGCGGCATGAAGGCTGTGGTCTGGACTGATGTGTTCCAGGTCGTGGTGATGCTAAGT
GGCTTCTGGGTTGTCCTGGCACGCGGTGTCATGCTTGTGGGCGGGCCCCGCCAGGTGCTC
ACGCTGGCCCAGAACCACTCCCGGATCAACCTCATGGACTTTAACCCTGACCCGAGGAGC
CGCTATACATTCTGGACTTTTGTGGTGGGTGGCACGTTGGTGTGGCTCTCCATGTATGGC
GTGAACCAGGCGCAGGTGCAGCGCTACGTGGCTTGCCGCACAGAGAAGCAGGCCAAGCTG
GCCCTGCTCATCAACCAGGTCGGCCTGTTCCTGATCGTGTCCAGCGCTGCCTGCTGTGGC
ATCGTCATGTTTGTGTTCTACACTGACTGCGACCCTCTCCTCCTGGGGCGCATCTCTGCC
CCAGACCAGTACATGCCTCTGCTGGTGCTGGACATCTTCGAAGATCTGCCTGGAGTCCCC
GGGCTTTTCCTGGCCTGTGCTTACAGTGGCACCCTCAGCACAGCATCCACCAGCATCAAT
GCTATGGCTGCAGTCACTGTAGAAGACCTCATCAAACCTCGGCTGCGGAGCCTGGCACCC
AGGAAACTCGTGATTATCTCCAAGGGGCTCTCACTCATCTACGGATCGGCCTGTCTCACC
GTGGCAGCCCTGTCCTCACTGCTCGGAGGAGGTGTCCTTCAGGGCTCCTTCACCGTCATG
GGAGTCATCAGCGGCCCCCTGCTGGGAGCCTTCATCTTGGGAATGTTCCTGCCGGCCTGC
AACACACCGGGCGTCCTCGCGGGACTAGGCGCGGGCTTGGCGCTGTCGCTGTGGGTGGCC
TTGGGCGCCACGCTGTACCCACCCAGCGAGCAGACCATGAGGGTCCTGCCATCGTCGGCT
GCCCGCTGCGTGGCTCTCTCAGTCAACGCCTCTGGCCTCCTGGACCCGGCTCTCCTCCCT
GCTAACGACTCCAGCAGGGCCCCCAGCTCAGGAATGGACGCCAGCCGACCCGCCTTAGCT
GACAGCTTCTATGCCATCTCCTATCTCTATTACGGTGCCCTGGGCACGCTGACCACTGTG
CTGTGCGGAGCCCTCATCAGCTGCCTGACAGGCCCCACCAAGCGCAGCACCCTGGCCCCG
GGATTGTTGTGGTGGGACCTCGCACGGCAGACAGCATCAGTGGCCCCCAAGGAAGAAGTG
GCCATCCTGGATGACAACTTGGTCAAGGGTCCTGAAGAACTCCCCACTGGAAACAAGAAG
CCCCCTGGCTTCCTGCCCACCAATGAGGATCGTCTGTTTTTCTTGGGGCAGAAGGAGCTG
GAGGGGGCTGGCTCTTGGACCCCCTGTGTTGGACATGATGGTGGTCGAGACCAGCAGGAG
ACAAACCTCTGA
Protein Properties
Number of Residues 643
Molecular Weight 68665.63
Theoretical pI 7.383
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium/iodide cotransporter
MEAVETGERPTFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLAALPVG
LSLSASFMSAVQVLGVPSEAYRYGLKFLWMCLGQLLNSVLTALLFMPVFYRLGLTSTYEY
LEMRFSRAVRLCGTLQYIVATMLYTGIVIYAPALILNQVTGLDIWASLLSTGIICTFYTA
VGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSRINLMDFNPDPRS
RYTFWTFVVGGTLVWLSMYGVNQAQVQRYVACRTEKQAKLALLINQVGLFLIVSSAACCG
IVMFVFYTDCDPLLLGRISAPDQYMPLLVLDIFEDLPGVPGLFLACAYSGTLSTASTSIN
AMAAVTVEDLIKPRLRSLAPRKLVIISKGLSLIYGSACLTVAALSSLLGGGVLQGSFTVM
GVISGPLLGAFILGMFLPACNTPGVLAGLGAGLALSLWVALGATLYPPSEQTMRVLPSSA
ARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYYGALGTLTTV
LCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKK
PPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q92911
UniProtKB/Swiss-Prot Entry Name SC5A5_HUMAN
PDB IDs Not Available
GenBank Gene ID U66088
GeneCard ID SLC5A5
GenAtlas ID SLC5A5
HGNC ID HGNC:11040
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Smanik PA, Liu Q, Furminger TL, Ryu K, Xing S, Mazzaferri EL, Jhiang SM: Cloning of the human sodium lodide symporter. Biochem Biophys Res Commun. 1996 Sep 13;226(2):339-45. [PubMed:8806637 ]
  4. Saito T, Endo T, Kawaguchi A, Ikeda M, Nakazato M, Kogai T, Onaya T: Increased expression of the Na+/I- symporter in cultured human thyroid cells exposed to thyrotropin and in Graves' thyroid tissue. J Clin Endocrinol Metab. 1997 Oct;82(10):3331-6. [PubMed:9329364 ]
  5. Fujiwara H, Tatsumi K, Miki K, Harada T, Miyai K, Takai S, Amino N: Congenital hypothyroidism caused by a mutation in the Na+/I- symporter. Nat Genet. 1997 Jun;16(2):124-5. [PubMed:9171822 ]
  6. Kosugi S, Inoue S, Matsuda A, Jhiang SM: Novel, missense and loss-of-function mutations in the sodium/iodide symporter gene causing iodide transport defect in three Japanese patients. J Clin Endocrinol Metab. 1998 Sep;83(9):3373-6. [PubMed:9745458 ]
  7. Pohlenz J, Rosenthal IM, Weiss RE, Jhiang SM, Burant C, Refetoff S: Congenital hypothyroidism due to mutations in the sodium/iodide symporter. Identification of a nonsense mutation producing a downstream cryptic 3' splice site. J Clin Invest. 1998 Mar 1;101(5):1028-35. [PubMed:9486973 ]
  8. Kosugi S, Bhayana S, Dean HJ: A novel mutation in the sodium/iodide symporter gene in the largest family with iodide transport defect. J Clin Endocrinol Metab. 1999 Sep;84(9):3248-53. [PubMed:10487695 ]