You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02902
Secondary Accession Numbers
  • 8410
Name Sodium/glucose cotransporter 1
Synonyms
  1. High affinity sodium-glucose cotransporter
  2. Na(+)/glucose cotransporter 1
  3. Solute carrier family 5 member 1
Gene Name SLC5A1
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Actively transports glucose into cells by Na(+) cotransport with a Na(+) to glucose coupling ratio of 2:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
Pathways
  • Bile secretion
  • Carbohydrate digestion and absorption
  • Lactose Degradation
  • Lactose Intolerance
  • Mineral absorption
  • Trehalose Degradation
Reactions Not Available
GO Classification
Biological Process
small molecule metabolic process
intestinal absorption
carbohydrate metabolic process
Cellular Component
cell-cell junction
brush border membrane
apical plasma membrane
integral to plasma membrane
Component
membrane
cell part
Function
transporter activity
Molecular Function
glucose:sodium symporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 22
Locus 22q12.3
SNPs SLC5A1
Gene Sequence
>1995 bp
ATGGACAGTAGCACCTGGAGCCCCAAGACCACCGCGGTCACCCGGCCTGTTGAGACCCAC
GAGCTCATTCGCAATGCAGCCGATATCTCCATCATCGTTATCTACTTCGTGGTAGTGATG
GCCGTCGGACTGTGGGCTATGTTTTCCACCAATCGTGGGACTGTTGGAGGCTTCTTCCTG
GCAGGCCGAAGTATGGTGTGGTGGCCGATTGGAGCCTCCCTCTTTGCTAGTAACATTGGA
AGTGGCCACTTTGTGGGGCTGGCCGGGACTGGGGCAGCTTCAGGCATCGCCATTGGAGGC
TTTGAATGGAATGCCCTGGTTTTGGTGGTTGTGCTGGGCTGGCTGTTTGTCCCCATCTAT
ATTAAGGCTGGGGTGGTGACAATGCCAGAGTACCTGAGGAAGCGGTTTGGAGGCCAGCGG
ATCCAGGTCTACCTTTCCCTTCTGTCCCTGCTGCTCTACATTTTCACCAAGATCTCGGCA
GACATCTTCTCGGGGGCCATATTCATCAATCTGGCCTTAGGCCTGAATCTGTATTTAGCC
ATCTTTCTCTTATTGGCAATCACTGCCCTTTACACAATTACAGGGGGCCTGGCGGCGGTG
ATTTACACGGACACCTTGCAGACGGTGATCATGCTGGTGGGGTCTTTAATCCTGACTGGG
TTTGCTTTTCACGAAGTGGGAGGCTATGACGCCTTCATGGAAAAGTACATGAAAGCCATT
CCAACCATAGTGTCTGATGGCAACACCACCTTTCAGGAAAAATGCTACACTCCAAGGGCC
GACTCCTTCCACATCTTCCGAGATCCCCTCACGGGAGACCTCCCATGGCCTGGGTTCATC
TTTGGGATGTCCATCCTTACCTTGTGGTACTGGTGCACAGATCAGGTCATTGTGCAGCGC
TGCCTCTCAGCCAAGAATATGTCTCACGTGAAGGGTGGCTGCATCCTGTGTGGGTATCTA
AAGCTGATGCCCATGTTCATCATGGTGATGCCAGGAATGATCAGCCGCATTCTGTACACA
GAAAAAATTGCCTGTGTCGTCCCTTCAGAATGTGAGAAATATTGCGGTACCAAGGTTGGC
TGTACCAACATCGCCTATCCAACCTTAGTGGTGGAGCTCATGCCCAATGGACTGCGAGGC
CTGATGCTATCAGTCATGCTGGCCTCCCTCATGAGCTCCCTGACCTCCATCTTCAACAGC
GCCAGCACCCTCTTCACCATGGACATCTACGCCAAGGTCCGCAAGAGAGCATCTGAGAAA
GAGCTCATGATTGCCGGAAGGTTGTTTATCCTGGTGCTGATTGGCATCAGCATCGCCTGG
GTGCCCATTGTGCAGTCAGCACAAAGTGGGCAACTCTTCGATTACATCCAGTCCATCACC
AGTTACTTGGGACCACCCATTGCGGCTGTCTTCCTGCTTGCTATTTTCTGGAAGAGAGTC
AATGAGCCAGGAGCCTTTTGGGGACTGATCCTAGGACTTCTGATTGGGATTTCACGTATG
ATTACTGAGTTTGCTTATGGAACCGGGAGCTGCATGGAGCCCAGCAACTGTCCCACGATT
ATCTGTGGGGTGCACTACTTGTACTTTGCCATTATCCTCTTCGCCATTTCTTTCATCACC
ATCGTGGTCATCTCCCTCCTCACCAAACCCATTCCGGATGTGCATCTCTACCGTCTGTGT
TGGAGCCTGCGCAACAGCAAAGAGGAGCGTATTGACCTGGATGCGGAAGAGGAGAACATC
CAAGAAGGCCCTAAGGAGACCATTGAAATAGAAACACAAGTTCCTGAGAAGAAAAAAGGA
ATCTTCAGGAGAGCCTATGACCTATTTTGTGGGCTAGAGCAGCACGGTGCACCCAAGATG
ACTGAGGAAGAGGAGAAAGCCATGAAGATGAAGATGACGGACACCTCTGAGAAGCCTTTG
TGGAGGACAGTGTTGAACGTCAATGGCATCATCCTGGTGACCGTGGCTGTCTTTTGCCAT
GCATATTTTGCCTGA
Protein Properties
Number of Residues 664
Molecular Weight 73497.275
Theoretical pI 7.685
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium/glucose cotransporter 1
MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFL
AGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIY
IKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLA
IFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAI
PTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR
CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVG
CTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEK
ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRV
NEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFIT
IVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG
IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCH
AYFA
GenBank ID Protein 189066539
UniProtKB/Swiss-Prot ID P13866
UniProtKB/Swiss-Prot Entry Name SC5A1_HUMAN
PDB IDs Not Available
GenBank Gene ID AK312948
GeneCard ID SLC5A1
GenAtlas ID SLC5A1
HGNC ID HGNC:11036
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Hediger MA, Turk E, Wright EM: Homology of the human intestinal Na+/glucose and Escherichia coli Na+/proline cotransporters. Proc Natl Acad Sci U S A. 1989 Aug;86(15):5748-52. [PubMed:2490366 ]
  5. Turk E, Martin MG, Wright EM: Structure of the human Na+/glucose cotransporter gene SGLT1. J Biol Chem. 1994 May 27;269(21):15204-9. [PubMed:8195156 ]
  6. Turk E, Kerner CJ, Lostao MP, Wright EM: Membrane topology of the human Na+/glucose cotransporter SGLT1. J Biol Chem. 1996 Jan 26;271(4):1925-34. [PubMed:8567640 ]
  7. Turk E, Zabel B, Mundlos S, Dyer J, Wright EM: Glucose/galactose malabsorption caused by a defect in the Na+/glucose cotransporter. Nature. 1991 Mar 28;350(6316):354-6. [PubMed:2008213 ]
  8. Lam JT, Martin MG, Turk E, Hirayama BA, Bosshard NU, Steinmann B, Wright EM: Missense mutations in SGLT1 cause glucose-galactose malabsorption by trafficking defects. Biochim Biophys Acta. 1999 Feb 24;1453(2):297-303. [PubMed:10036327 ]
  9. Kasahara M, Maeda M, Hayashi S, Mori Y, Abe T: A missense mutation in the Na(+)/glucose cotransporter gene SGLT1 in a patient with congenital glucose-galactose malabsorption: normal trafficking but inactivation of the mutant protein. Biochim Biophys Acta. 2001 May 31;1536(2-3):141-7. [PubMed:11406349 ]