Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03079
Secondary Accession Numbers
  • 8615
Name Sodium-dependent phosphate transport protein 2C
Synonyms
  1. Na(+)-dependent phosphate cotransporter 2C
  2. Na(+)/Pi cotransporter 2C
  3. NaPi-2c
  4. Sodium-phosphate transport protein 2C
  5. Sodium/inorganic phosphate cotransporter IIC
  6. Sodium/phosphate cotransporter 2C
  7. Solute carrier family 34 member 3
Gene Name SLC34A3
Protein Type Unknown
Biological Properties
General Function Inorganic ion transport and metabolism
Specific Function May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Probably mediates 20-30% of the apical influx.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
cellular phosphate ion homeostasis
response to magnesium ion
response to nutrient levels
Cellular Component
brush border membrane
apical plasma membrane
cytoplasmic vesicle
integral to membrane
Component
membrane
cell part
Function
inorganic anion transmembrane transporter activity
phosphate transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
sodium-dependent phosphate transmembrane transporter activity
transporter activity
anion transmembrane transporter activity
Molecular Function
sodium-dependent phosphate transmembrane transporter activity
sodium:phosphate symporter activity
Process
establishment of localization
transport
phosphate transport
anion transport
inorganic anion transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 9
Locus 9q34
SNPs SLC34A3
Gene Sequence
>1800 bp
ATGCCGAGTTCCCTTCCCGGCAGCCAGGTCCCCCACCCCACTCTGGACGCGGTTGACCTA
GTGGAAAAGACTCTGAGGAATGAAGGGACCTCCAGTTCTGCTCCAGTCTTGGAGGAAGGG
GACACAGACCCCTGGACCCTCCCTCAGCTGAAGGACACAAGCCAGCCCTGGAAAGAGCTC
CGCGTGGCCGGCAGGCTGCGCCGCGTGGCCGGCAGCGTCCTCAAGGCCTGCGGGCTCCTC
GGCAGCCTGTACTTCTTCATCTGCTCTCTGGACGTCCTCAGCTCCGCCTTCCAGCTGCTG
GGCAGCAAAGTGGCCGGAGACATCTTCAAGGACAACGTGGTGCTGTCCAACCCTGTGGCT
GGACTGGTCATTGGCGTGCTGGTCACAGCCCTGGTGCAGAGTTCCAGCACGTCCTCCTCC
ATCGTGGTCAGCATGGTGGCTGCTAAGCTGCTGACTGTCCGGGTGTCTGTGCCCATCATC
ATGGGTGTCAACGTAGGCACATCCATCACCAGCACCCTGGTCTCAATGGCGCAGTCAGGG
GACCGGGATGAATTTCAGAGGGCTTTCAGCGGCTCGGCGGTGCACGGGATCTTCAACTGG
CTCACAGTGCTGGTCCTGCTGCCACTGGAGAGCGCCACGGCCCTGCTGGAGAGGCTAAGT
GAGCTAGCCCTGGGTGCCGCCAGCCTGACACCCAGGGCGCAGGCGCCCGACATCCTCAAG
GTGCTGACGAAGCCGCTCACACACCTCATCGTGCAGTTGGACTCCGACATGATCATGAGC
AGTGCCACAGGCAACGCCACTAACAGCAGTCTCATTAAGCACTGGTGCGGCACCACGGGG
CAGCCGACCCAGGAGAACAGCAGCTGTGGCGCCTTCGGCCCGTGCACAGAGAAGAACAGC
ACAGCCCCGGCGGACAGGCTGCCCTGCCGCCACCTGTTTGCGGGCACGGAGCTCACGGAC
CTGGCCGTGGGCTGCATCCTGCTGGCCGGCTCCCTGCTGGTGCTCTGCGGCTGCCTGGTC
CTCATAGTCAAGCTGCTCAACTCTGTGCTGCGCGGCCGCGTGGCCCAGGTCGTGAGGACA
GTCATCAATGCGGACTTCCCCTTCCCGCTGGGCTGGCTCGGCGGCTACCTGGCCGTCCTC
GCGGGCGCCGGCCTGACCTTCGCACTGCAGAGCAGCAGCGTCTTCACGGCGGCCGTCGTG
CCCCTCATGGGGGTCGGGGTGATCAGTCTGGACCGGGCGTACCCCCTCTTACTGGGCTCC
AACATCGGCACCACTACCACAGCCCTGCTGGCTGCCCTGGCCAGCCCCGCAGACAGGATG
CTCAGCGCCCTGCAGGTCGCCCTCATCCACTTCTTCTTCAACCTGGCCGGCATCCTGCTG
TGGTACCTGGTGCCTGCACTGCGGCTGCCCATCCCGCTGGCCAGGCACTTCGGGGTGGTG
ACCGCCCGTTACCGCTGGGTGGCTGGGGTCTACCTGCTGCTCGGATTCCTGCTGCTGCCC
CTGGCGGCCTTCGGGCTCTCCCTGGCAGGGGGCATGGTGCTGGCCGCTGTCGGGGGTCCC
CTGGTGGGGCTGGTGCTCCTCGTCATCCTGGTTACTGTCCTGCAGCGGCGCCGGCCGGCC
TGGCTGCCTGTCCGCCTGCGCTCCTGGGCCTGGCTCCCCGTCTGGCTCCATTCTCTGGAG
CCCTGGGACCGCCTGGTGACCCGCTGCTGCCCCTGCAACGTCTGCAGCCCCCCGAAGGCC
ACCACCAAAGAGGCCTACTGCTACGAGAACCCTGAGATCTTGGCCTCCCAGCAGTTGTGA
Protein Properties
Number of Residues 599
Molecular Weight 63518.96
Theoretical pI 8.364
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium-dependent phosphate transport protein 2C
MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKEL
RVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVA
GLVIGVLVTALVQSSSTSSSIVVSMVAAKLLTVRVSVPIIMGVNVGTSITSTLVSMAQSG
DRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASLTPRAQAPDILK
VLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNS
TAPADRLPCRHLFAGTELTDLAVGCILLAGSLLVLCGCLVLIVKLLNSVLRGRVAQVVRT
VINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVVPLMGVGVISLDRAYPLLLGS
NIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVV
TARYRWVAGVYLLLGFLLLPLAAFGLSLAGGMVLAAVGGPLVGLVLLVILVTVLQRRRPA
WLPVRLRSWAWLPVWLHSLEPWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL
GenBank ID Protein 18147578
UniProtKB/Swiss-Prot ID Q8N130
UniProtKB/Swiss-Prot Entry Name NPT2C_HUMAN
PDB IDs Not Available
GenBank Gene ID AB055000
GeneCard ID SLC34A3
GenAtlas ID Not Available
HGNC ID HGNC:20305
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  3. Segawa H, Kaneko I, Takahashi A, Kuwahata M, Ito M, Ohkido I, Tatsumi S, Miyamoto K: Growth-related renal type II Na/Pi cotransporter. J Biol Chem. 2002 May 31;277(22):19665-72. Epub 2002 Mar 5. [PubMed:11880379 ]
  4. Bergwitz C, Roslin NM, Tieder M, Loredo-Osti JC, Bastepe M, Abu-Zahra H, Frappier D, Burkett K, Carpenter TO, Anderson D, Garabedian M, Sermet I, Fujiwara TM, Morgan K, Tenenhouse HS, Juppner H: SLC34A3 mutations in patients with hereditary hypophosphatemic rickets with hypercalciuria predict a key role for the sodium-phosphate cotransporter NaPi-IIc in maintaining phosphate homeostasis. Am J Hum Genet. 2006 Feb;78(2):179-92. Epub 2005 Dec 9. [PubMed:16358214 ]
  5. Lorenz-Depiereux B, Benet-Pages A, Eckstein G, Tenenbaum-Rakover Y, Wagenstaller J, Tiosano D, Gershoni-Baruch R, Albers N, Lichtner P, Schnabel D, Hochberg Z, Strom TM: Hereditary hypophosphatemic rickets with hypercalciuria is caused by mutations in the sodium-phosphate cotransporter gene SLC34A3. Am J Hum Genet. 2006 Feb;78(2):193-201. Epub 2005 Dec 9. [PubMed:16358215 ]