You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03124
Secondary Accession Numbers
  • 8668
Name Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
Synonyms Not Available
Gene Name ECH1
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Isomerization of 3-trans,5-cis-dienoyl-CoA to 2-trans,4- trans-dienoyl-CoA
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
Process
metabolic process
Cellular Location
  1. Mitochondrion
  2. Peroxisome
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.1
SNPs ECH1
Gene Sequence
>987 bp
ATGGCGGCGGGGATAGTGGCTTCTCGCAGACTCCGCGACCTACTGACCCGGCGACTGACA
GGCTCCAACTACCCGGGACTCAGTATTAGCCTTCGCCTCACTGGCTCCTCTGCACAAGAG
GAGGCTTCCGGAGTAGCCCTCGGTGAAGCCCCAGACCACAGCTATGAGTCCCTTCGTGTG
ACGTCTGCGCAGAAACATGTTCTGCATGTCCAGCTCAACCGGCCCAACAAGAGGAATGCC
ATGAACAAGGTCTTCTGGAGAGAGATGGTAGAGTGCTTCAACAAGATTTCGAGAGACGCT
GACTGTCGGGCGGTGGTGATCTCTGGTGCAGGAAAAATGTTCACTGCAGGTATTGACCTG
ATGGACATGGCTTCGGACATCCTGCAGCCCAAAGGAGATGATGTGGCCCGGATCAGCTGG
TACCTCCGTGACATCATCACTCGATACCAGGAGACCTTCAACGTCATCGAGAGGTGCCCC
AAGCCCGTGATTGCTGCCGTCCATGGGGGCTGCATTGGCGGAGGTGTGGACCTTGTCACC
GCCTGTGACATCCGGTACTGTGCCCAGGATGCTTTCTTCCAGGTGAAGGAGGTGGACGTG
GGTTTGGCTGCCGATGTAGGAACACTGGAGCGCCTGCCCAAGGTCATCGGGAACCAGAGC
CTGGTCAACGAGCTGGCCTTCACCGCCCACAAGATGATGGCTGACGAGGCCCTGGACAGT
GGGCTGGTCAGCCGGGTGTTCCCAGACAAAGAGGTCATGCTGGATGCTGCCTTACCCCTG
GCGCCCGAGATTTCCAGCAAGACCACCGTGTTGGTGCAGAGCACCAAGGTCAACCTGCTG
TATTCCCGCGACCATTCGGTGGCCGAGAGCCTCAACTACGTGGCGTCCTGGAACATGAGC
ATGCTGCAGACCCAAGACCTCGTGAAGTCGGTCCAGCCCACGACTGAGAACAAGGAACTG
AAAACCGTCACCTTCTCCAAGCTCTGA
Protein Properties
Number of Residues 328
Molecular Weight 35815.8
Theoretical pI 8.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRV
TSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDL
MDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVT
ACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGS
GLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMS
MLQTQDLVKSVQATTENKELKTVTFSKL
GenBank ID Protein 2623168
UniProtKB/Swiss-Prot ID Q13011
UniProtKB/Swiss-Prot Entry Name ECH1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF030249
GeneCard ID ECH1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. FitzPatrick DR, Germain-Lee E, Valle D: Isolation and characterization of rat and human cDNAs encoding a novel putative peroxisomal enoyl-CoA hydratase. Genomics. 1995 Jun 10;27(3):457-66. [PubMed:7558027 ]