You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03197
Secondary Accession Numbers
  • 8761
Name Chondroitin sulfate N-acetylgalactosaminyltransferase 2
Synonyms
  1. Beta4GalNAcT-2
  2. Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 2
  3. GalNAcT-2
Gene Name CSGALNACT2
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring hexosyl groups
Specific Function Transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). Required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.
Pathways
  • Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Reactions
Uridine diphosphate-N-acetylgalactosamine + beta-D-glucuronyl-(1->3)-D-galactosyl-proteoglycan → Uridine 5'-diphosphate + N-acetyl-D-galactosaminyl-(1->4)-beta-D-glucuronyl-(1->3)-beta-D-galactosylproteoglycan details
UDP-N-acetyl-D-galactosamine + → UDP + details
GO Classification
Biological Process
chondroitin sulfate biosynthetic process
chondroitin sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process
dermatan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process
Cellular Component
Golgi cisterna membrane
integral to Golgi membrane
Component
golgi membrane
membrane
cell part
organelle membrane
golgi cisterna membrane
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
acetylgalactosaminyltransferase activity
metal ion binding
glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase activity
Cellular Location
  1. Golgi apparatus
  2. Golgi stack membrane
  3. Single-pass type II membrane protein (Probable)
Gene Properties
Chromosome Location 10
Locus 10q11.21
SNPs CSGALNACT2
Gene Sequence
>1629 bp
ATGCCTAGAAGAGGACTGATTCTTCACACCCGGACCCACTGGTTGCTGTTGGGCCTTGCT
TTGCTCTGCAGTTTGGTATTATTTATGTACCTCCTGGAATGTGCCCCCCAGACTGATGGA
AATGCATCTCTTCCTGGTGTTGTTGGGGAAAATTATGGTAAAGAGTATTATCAAGCCCTC
CTACAGGAACAAGAAGAACATTATCAGACCAGGGCAACCAGTCTGAAACGCCAAATTGCC
CAACTAAAACAAGAATTACAAGAAATGAGTGAGAAGATGCGGTCACTGCAAGAAAGAAGG
AATGTAGGGGCTAATGGCATAGGCTATCAGAGCAACAAAGAGCAAGCACCTAGTGATCTT
TTAGAGTTTCTTCATTCCCAAATTGACAAAGCTGAAGTTAGCATAGGGGCCAAACTACCC
AGTGAGTATGGGGTCATTCCCTTTGAAAGTTTTACCTTAATGAAAGTATTTCAATTGGAA
ATGGGTCTCACTCGCCATCCTGAAGAAAAGCCAGTTAGAAAAGACAAACGAGATGAATTG
GTGGAAGTTATTGAAGCGGGCTTGGAGGTCATTAATAATCCTGATGAAGATGATGAACAA
GAAGATGAGGAGGGTCCCCTTGGAGAGAAACTGATATTTAATGAAAATGACTTCGTAGAA
GGTTATTATCGCACTGAGAGAGATAAGGGCACACAGTATGAACTCTTTTTTAAGAAAGCA
GACCTTACGGAATATAGACATGTGACCCTCTTCCGCCCTTTTGGACCTCTCATGAAAGTG
AAGAGTGAGATGATTGACATCACTAGATCAATTATTAATATCATTGTGCCACTTGCTGAA
AGAACTGAAGCATTTGTACAATTTATGCAGAACTTCAGGGATGTTTGTATTCATCAAGAC
AAGAAGATTCATCTCACAGTGGTGTATTTTGGTAAAGAAGGACTGTCTAAAGTCAAGTCT
ATCCTAGAATCTGTCACCAGTGAGTCTAATTTTCACAATTACACCTTGGTCTCATTGAAT
GAAGAATTTAATCGTGGACGAGGACTAAATGTGGGTGCCCGAGCTTGGGACAAGGGAGAG
GTCTTGATGTTTTTCTGTGATGTTGATATCTATTTCTCAGCCGAATTCCTTAACAGCTGC
CGGTTAAATGCTGAGCCAGGTAAGAAGGTGTTTTACCCTGTGGTGTTCAGTCTTTACAAT
CCTGCCATTGTTTATGCCAACCAGGAAGTGCCACCACCTGTGGAGCAGCAGCTGGTTCAC
AAAAAGGATTCTGGCTTTTGGCGAGATTTTGGCTTTGGAATGACTTGTCAGTATCGTTCA
GATTTCCTGACCATTGGTGGATTTGACATGGAAGTGAAAGGTTGGGGTGGAGAAGATGTT
CATCTTTATCGAAAATACTTACATGGTGACCTCATTGTGATTCGGACTCCGGTTCCTGGT
CTTTTCCACCTCTGGCATGAAAAGCGCTGTGCTGATGAGCTGACCCCCGAGCAGTACCGC
ATGTGCATCCAGTCTAAAGCCATGAATGAGGCCTCTCACTCCCACCTGGGAATGCTGGTC
TTCAGGGAGGAAATAGAGACGCATCTTCATAAACAGGCATACAGGACAAACAGTGAAGCT
GTTGGTTGA
Protein Properties
Number of Residues 542
Molecular Weight 62571.875
Theoretical pI 5.729
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Chondroitin sulfate N-acetylgalactosaminyltransferase 2
MPRRGLILHTRTHWLLLGLALLCSLVLFMYLLECAPQTDGNASLPGVVGENYGKEYYQAL
LQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMRSLQERRNVGANGIGYQSNKEQAPSDL
LEFLHSQIDKAEVSIGAKLPSEYGVIPFESFTLMKVFQLEMGLTRHPEEKPVRKDKRDEL
VEVIEAGLEVINNPDEDDEQEDEEGPLGEKLIFNENDFVEGYYRTERDKGTQYELFFKKA
DLTEYRHVTLFRPFGPLMKVKSEMIDITRSIINIIVPLAERTEAFVQFMQNFRDVCIHQD
KKIHLTVVYFGKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLNVGARAWDKGE
VLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNPAIVYANQEVPPPVEQQLVH
KKDSGFWRDFGFGMTCQYRSDFLTIGGFDMEVKGWGGEDVHLYRKYLHGDLIVIRTPVPG
LFHLWHEKRCADELTPEQYRMCIQSKAMNEASHSHLGMLVFREEIETHLHKQAYRTNSEA
VG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8N6G5
UniProtKB/Swiss-Prot Entry Name CGAT2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB079252
GeneCard ID CSGALNACT2
GenAtlas ID CSGALNACT2
HGNC ID HGNC:24292
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Sato T, Gotoh M, Kiyohara K, Akashima T, Iwasaki H, Kameyama A, Mochizuki H, Yada T, Inaba N, Togayachi A, Kudo T, Asada M, Watanabe H, Imamura T, Kimata K, Narimatsu H: Differential roles of two N-acetylgalactosaminyltransferases, CSGalNAcT-1, and a novel enzyme, CSGalNAcT-2. Initiation and elongation in synthesis of chondroitin sulfate. J Biol Chem. 2003 Jan 31;278(5):3063-71. Epub 2002 Nov 20. [PubMed:12446672 ]
  5. Yu Y, Zhang C, Zhou G, Wu S, Qu X, Wei H, Xing G, Dong C, Zhai Y, Wan J, Ouyang S, Li L, Zhang S, Zhou K, Zhang Y, Wu C, He F: Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs. Genome Res. 2001 Aug;11(8):1392-403. [PubMed:11483580 ]
  6. Uyama T, Kitagawa H, Tanaka J, Tamura J, Ogawa T, Sugahara K: Molecular cloning and expression of a second chondroitin N-acetylgalactosaminyltransferase involved in the initiation and elongation of chondroitin/dermatan sulfate. J Biol Chem. 2003 Jan 31;278(5):3072-8. Epub 2002 Nov 13. [PubMed:12433924 ]