You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03276
Secondary Accession Numbers
  • 8851
Name Type II inositol 3,4-bisphosphate 4-phosphatase
Synonyms
  1. Inositol polyphosphate 4-phosphatase type II
Gene Name INPP4B
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatidyl-inositol-4,5-bisphosphate 4-ph
Specific Function Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate.
Pathways
  • Inositol phosphate metabolism
  • Inositol Phosphate Metabolism
  • Joubert syndrome
  • Phosphatidylinositol Phosphate Metabolism
  • phosphatidylinositol signaling pathway
  • Phosphatidylinositol signaling system
Reactions
1-phosphatidyl-myo-inositol 3,4-bisphosphate + Water → 1-phosphatidyl-1D-myo-inositol 3-phosphate + Phosphoric acid details
1D-Myo-inositol 3,4-bisphosphate + Water → Myo-inositol 1-phosphate + Phosphoric acid details
1-Phosphatidyl-1D-myo-inositol 3,4-bisphosphate + Water → 1-Phosphatidyl-1D-myo-inositol 3-phosphate + Phosphoric acid details
GO Classification
Biological Process
small molecule metabolic process
signal transduction
Cellular Component
cytosol
Molecular Function
phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity
phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4q31.21
SNPs INPP4B
Gene Sequence
>2775 bp
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAG
GCCAATGATCCCGGGGACTGTCAGTTCACAAGTATCCAGAAGACTCCAAATGAACCGCAG
TTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGC
ACCGAAATTGTGGAGGGAACAAGGGACCCACTGTTTTTGACTGGTGTCACATTCCCATCT
GAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCGTTCGAACCAGTGTCCTACCAGAACATAAGGATCCCCCGCCAGAAGTT
GGGCGAAGTTTCTTGGGCTATGCCAGTTTTAAAGTGGGAGAGCTGCTGAAGTCAAAGGAG
CAATTGCTGGTCCTGAGCCTGAGAACTTCAGATGGTGGCAAAGTGGTTGGCACCATAGAA
GTCAGTGTCGTGAAGATGGGGGAGATTGAGGATGGGGAAGCCGACCACATCACCACAGAT
GTACAGGGACAAAAGTGTGCCCTGGTATGTGAATGTACAGCCCCGGAAAGTGTGAGCGGA
AAAGATAACTTACCTTTTTTGAATTCAGTGTTAAAGAACCCAGTATGTAAATTATATAGA
TTTCCCACATCTGACAATAAGTGGATGCGAATTCGAGAGCAGATGTCAGAGAGCATTCTT
TCCTTTCATATTCCTAAGGAATTGATTTCCCTTCACATTAAAGAAGATTTGTGCAGAAAC
CAGGAGATAAAAGAACTTGGTGAGCTTTCTCCACATTGGGACAATCTGCGAAAAAATGTC
CTTACTCACTGTGATCAAATGGTGAATATGTACCAAGACATTCTGACAGAACTTAGCAAG
GAAACAGGGTCCTCTTTCAAATCAAGCAGCAGCAAAGGAGAGAAAACATTAGAATTTGTT
CCAATAAATCTACATCTGCAAAGAATGCAGGTACACAGCCCTCACTTGAAAGATGCTCTC
TACGATGTCATCACTGTGGGAGCCCCAGCTGCCCATTTTCAGGGATTTAAGAATGGTGGT
CTTCGGAAGCTACTCCATAGATTTGAAACAGAAAGAAGAAATACCGGATACCAGTTTATT
TACTATTCACCTGAAAACACAGCCAAAGCAAAGGAAGTTCTCAGCAACATCAATCAACTA
CAACCTCTTATAGCAACCCATGCAGACCTACTGCTTAATTCTGCAAGCCAGCATTCTCCA
GACAGCTTGAAGAATTCTTTAAAGATGCTTTCAGAAAAAACAGAGCTTTTTGTACATGCC
TTCAAGGATCAACTTGTCAGGAGTGCTCTTTTAGCACTCTACACTGCAAGGCCAGGAGGC
ATTCTTAAGAAGCCACCCTCTCCTAAGAGCAGCACAGAGGAGAGCAGTCCCCAAGACCAA
CCCCCAGTGATGAGAGGGCAGGACTCCATACCACATCATTCAGACTATGATGAGGAAGAG
TGGGACAGGGTGTGGGCCAATGTGGGGAAGAGCCTGAACTGCATTATTGCTATGGTGGAC
AAACTGATTGAAAGAGATGGTGGCAGTGAAGGCAGTGGCGGCAACAATGATGGAGAAAAG
GAACCTTCATTAACAGATGCCATTCCCTCTCACCCAAGAGAGGACTGGTATGAACAGTTG
TATCCCCTCATCCTTACCCTGAAGGACTGCATGGGAGAAGTGGTGAACCGAGCCAAGCAG
TCCCTGACATTTGTGCTCCTTCAGGAACTTGCGTACAGCTTGCCCCAGTGTCTGATGCTG
ACGCTAAGAAGAGACATCGTCTTCAGCCAAGCACTTGCTGGATTGGTTTGTGGTTTTATC
ATCAAATTACAGACAAGTCTGTATGACCCAGGCTTCCTACAGCAGCTTCACACAGTGGGG
TTGATAGTACAATATGAAGGACTGCTAAGTACATACAGCGATGAAATTGGAATGCTAGAG
GACATGGCCGTTGGCATTTCCGATTTAAAGAAAGTTGCATTTAAAATAATTGAAGCCAAA
TCCAATGATGTGTTGCCAGTTATAACAGGAAGACGAGAACATTACGTGGTAGAGGTCAAG
CTTCCAGCCAGAATGTTTGAGTCACTACCTCTACAGATTAAAGAAGGACAGTTGCTTCAT
GTGTATCCAGTACTTTTTAATGTTGGAATCAATGAACAGCAAACTCTGGCTGAAAGGTTT
GGAGATGTCTCTTTGCAAGAAAGTATTAATCAGGAAAACTTCGAACTTCTACAAGAATAT
TACAAGATATTTATGGAAAAGATGCCTCCTGATTATATTTCACATTTTCAGGAACAAAAT
GATTTAAAAGCATTGCTAGAAAATCTCCTTCAAAATATCCAATCCAAAAAAAGAAAGAAT
GTAGAAATTATGTGGCTGGCTGCAACGATTTGCCGCAAACTGAATGGTATTCGTTTCACC
TGTTGTAAAAGTGCCAAAGACAGGACATCGATGTCAGTGACACTTGAACAATGCTCAATC
TTGAGAGATGAGCACCAGTTACACAAGGACTTCTTTATCCGAGCGCTGGATTGCATGAGA
AGAGAAGGATGCCGCATAGAGAATGTACTGAAGAATATCAAATGCAGAAAGTATGCTTTC
AACATGCTACAGCTGATGGCTTTCCCCAAGTACTACAGACCTCCAGAGGGGACTTATGGA
AAAGCTGACACCTAA
Protein Properties
Number of Residues 924
Molecular Weight 104737.105
Theoretical pI 6.263
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Type II inositol-3,4-bisphosphate 4-phosphatase
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLN
TLVQISVIHPVEQSLTRYSSTEIVEGTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDK
SHDTVRTSVLPEHKDPPPEVGRSFLGYASFKVGELLKSKEQLLVLSLRTSDGGKVVGTIE
VSVVKMGEIEDGEADHITTDVQGQKCALVCECTAPESVSGKDNLPFLNSVLKNPVCKLYR
FPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRNQEIKELGELSPHWDNLRKNV
LTHCDQMVNMYQDILTELSKETGSSFKSSSSKGEKTLEFVPINLHLQRMQVHSPHLKDAL
YDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGG
ILKKPPSPKSSTEESSPQDQPPVMRGQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVD
KLIERDGGSEGSGGNNDGEKEPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQ
SLTFVLLQELAYSLPQCLMLTLRRDIVFSQALAGLVCGFIIKLQTSLYDPGFLQQLHTVG
LIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAKSNDVLPVITGRREHYVVEVK
LPARMFESLPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESINQENFELLQEY
YKIFMEKMPPDYISHFQEQNDLKALLENLLQNIQSKKRKNVEIMWLAATICRKLNGIRFT
CCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNIKCRKYAF
NMLQLMAFPKYYRPPEGTYGKADT
GenBank ID Protein 156104897
UniProtKB/Swiss-Prot ID O15327
UniProtKB/Swiss-Prot Entry Name INP4B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001101669.1
GeneCard ID INPP4B
GenAtlas ID Not Available
HGNC ID HGNC:6075
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Norris FA, Atkins RC, Majerus PW: The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family. J Biol Chem. 1997 Sep 19;272(38):23859-64. [PubMed:9295334 ]