You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP04017
Secondary Accession Numbers
  • 9606
Name V-type proton ATPase subunit H
Synonyms
  1. NBP1
  2. Nef-binding protein 1
  3. V-ATPase 50/57 kDa subunits
  4. V-ATPase subunit H
  5. VMA13
  6. Vacuolar proton pump subunit H
  7. Vacuolar proton pump subunit SFD
Gene Name ATP6V1H
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit H activates the ATPase activity of the enzyme and couples ATPase activity to proton flow. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. Involved in the endocytosis mediated by clathrin-coated pits, required for the formation of endosomes
Pathways Not Available
Reactions Not Available
GO Classification
Component
proton-transporting two-sector atpase complex, catalytic domain
proton-transporting v-type atpase, v1 domain
macromolecular complex
protein complex
vacuolar proton-transporting v-type atpase, v1 domain
Function
binding
catalytic activity
hydrolase activity
proton-transporting atpase activity, rotational mechanism
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
atp synthesis coupled proton transport
atp biosynthetic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:8
Locus 8q11.2
SNPs ATP6V1H
Gene Sequence
>1452 bp
ATGACCAAAATGGATATCCGAGGTGCTGTGGATGCTGCTGTCCCCACCAATATTATTGCT
GCCAAGGCTGCAGAAGTTCGTGCAAACAAAGTCAACTGGCAATCCTATCTTCAGGGACAG
ATGATTTCTGCTGAAGATTGTGAGTTTATTCAGAGGTTTGAAATGAAACGAAGCCCTGAA
GAGAAGCAAGAGATGCTTCAAACTGAAGGCAGCCAGTGTGCTAAAACATTTATAAATCTG
ATGACTCATATCTGCAAAGAACAGACCGTTCAGTATATACTAACTATGGTGGATGATATG
CTGCAGGAAAATCATCAGCGTGTTAGCATTTTCTTTGACTATGCAAGATGTAGCAAGAAC
ACTGCGTGGCCCTACTTTCTGCCAATGTTGAATCGCCAGGATCCCTTCACTGTTCATATG
GCAGCAAGAATTATTGCCAAGTTAGCAGCTTGGGGAAAAGAACTGATGGAAGGCAGTGAC
TTAAATTACTATTTCAATTGGATAAAAACTCAGCTGAGTTCACAGAAACTGCGTGGTAGC
GGTGTTGCTGTTGAAACAGGAACAGTCTCTTCAAGTGATAGTTCGCAGTATGTGCAGTGC
GTGGCCGGGTGTTTGCAGCTGATGCTCCGGGTCAATGAGTACCGCTTTGCTTGGGTGGAA
GCAGATGGGGTAAATTGCATAATGGGAGTGTTGAGTAACAAGTGTGGCTTTCAGCTCCAG
TATCAAATGATTTTTTCAATATGGCTCCTGGCATTCAGTCCTCAAATGTGTGAACACCTG
CGGCGCTATAATATCATTCCAGTTCTGTCTGATATCCTTCAGGAGTCTGTCAAAGAGAAA
GTAACAAGAATCATTCTTGCAGCATTTCGTAACTTTTTAGAAAAATCAACTGAAAGAGAA
ACTCGCCAAGAATATGCCCTGGCTATGATTCAGTGCAAAGTTCTGAAACAGTTGGAGAAC
TTGGAACAGCAGAAGTACGATGATGAAGATATCAGCGAAGATATCAAATTTCTTTTGGAA
AAACTTGGAGAGAGTGTCCAGGACCTTAGTTCATTTGATGAATACAGTTCAGAACTTAAA
TCTGGAAGGTTGGAATGGAGTCCTGTGCACAAATCTGAGAAATTTTGGAGAGAGAATGCT
GTGAGGTTAAATGAGAAGAATTATGAACTCTTGAAAATCTTGACAAAACTTTTGGAAGTG
TCAGATGATCCCCAAGTCTTAGCTGTTGCTGCTCACGATGTTGGAGAATATGTGCGGCAT
TATCCACGAGGCAAACGGGTCATCGAGCAGCTCGGTGGGAAGCAGCTGGTCATGAACCAC
ATGCATCATGAAGACCAGCAGGTCCGCTATAATGCTCTGCTGGCCGTGCAGAAGCTCATG
GTGCACAACTGGGAATACCTTGGCAAGCAGCTCCAGTCCGAGCAGCCCCAGACCGCTGCC
GCCCGAAGCTAA
Protein Properties
Number of Residues 483
Molecular Weight 55882.7
Theoretical pI 6.44
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>V-type proton ATPase subunit H
MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPE
EKQEMLQTEGSQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKN
TAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGS
GVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQ
YQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERE
TRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELK
SGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH
YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAA
ARS
GenBank ID Protein 6563196
UniProtKB/Swiss-Prot ID Q9UI12
UniProtKB/Swiss-Prot Entry Name VATH_HUMAN
PDB IDs Not Available
GenBank Gene ID AF112204
GeneCard ID ATP6V1H
GenAtlas ID ATP6V1H
HGNC ID HGNC:18303
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Genome Res. 2000 May;10(5):703-13. [PubMed:10810093 ]
  6. Lu X, Yu H, Liu SH, Brodsky FM, Peterlin BM: Interactions between HIV1 Nef and vacuolar ATPase facilitate the internalization of CD4. Immunity. 1998 May;8(5):647-56. [PubMed:9620685 ]
  7. Geyer M, Yu H, Mandic R, Linnemann T, Zheng YH, Fackler OT, Peterlin BM: Subunit H of the V-ATPase binds to the medium chain of adaptor protein complex 2 and connects Nef to the endocytic machinery. J Biol Chem. 2002 Aug 9;277(32):28521-9. Epub 2002 May 24. [PubMed:12032142 ]