Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05240
Secondary Accession Numbers
  • 10838
Name Sodium-independent sulfate anion transporter
Synonyms
  1. Solute carrier family 26 member 11
Gene Name SLC26A11
Protein Type Unknown
Biological Properties
General Function Involved in secondary active sulfate transmembrane transporter activity
Specific Function Exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC).
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
sulfate transport
Cellular Component
endoplasmic reticulum
plasma membrane
Golgi apparatus
lysosomal membrane
integral to membrane
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
inorganic anion transmembrane transporter activity
sulfate transmembrane transporter activity
secondary active sulfate transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
anion transmembrane transporter activity
Molecular Function
anion transmembrane transporter activity
anion:anion antiporter activity
secondary active sulfate transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
anion transport
inorganic anion transport
sulfate transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 17
Locus 17q25.3
SNPs SLC26A11
Gene Sequence
>1821 bp
ATGCCTTCTTCGGTGACGGCGCTGGGTCAGGCCAGGTCCTATGGCCCCGGGATGGCCCCG
AGCGCCTGCTGCTGCTCCCCTGCGGCCCTGCAGAGGAGGCTGCCCATCCTGGCGTGGCTG
CCCAGCTACTCCCTGCAGTGGCTGAAGATGGATTTCGTCGCCGGCCTCTCAGTTGGCCTC
ACTGCCATTCCCCAGGCGCTGGCCTATGCTGAAGTGGCTGGACTCCCGCCCCAGTATGGC
CTCTACTCTGCCTTCATGGGCTGCTTCGTGTATTTCTTCCTGGGCACCTCCCGGGATGTG
ACTCTGGGCCCCACCGCCATTATGTCCCTCCTGGTCTCCTTCTACACCTTCCATGAGCCC
GCCTACGCTGTGCTGCTGGCCTTCCTGTCCGGCTGCATCCAGCTGGCCATGGGGGTCCTG
CGTTTGGGGTTCCTGCTGGACTTCATTTCCTACCCCGTCATTAAAGGCTTCACCTCTGCT
GCTGCCGTCACCATCGGCTTTGGACAGATCAAGAACCTGCTGGGACTACAGAACATCCCC
AGGCCGTTCTTCCTGCAGGTGTACCACACCTTCCTCAGGATTGCAGAGACCAGGGTAGGT
GACGCCGTCCTGGGGCTGGTCTGCATGCTGCTGCTGCTGGTGCTGAAGCTGATGCGGGAC
CACGTGCCTCCCGTCCACCCCGAGATGCCCCCTGGTGTGCGGCTCAGCCGTGGGCTGGTC
TGGGCTGCCACGACAGCTCGCAACGCCCTGGTGGTCTCCTTCGCAGCCCTGGTTGCGTAC
TCCTTCGAGGTGACTGGATACCAGCCTTTCATCCTAACAGGGGAGACAGCTGAGGGGCTC
CCTCCAGTCCGGATCCCGCCCTTCTCAGTGACCACAGCCAACGGGACGATCTCCTTCACC
GAGATGGTGCAGGACATGGGAGCCGGGCTGGCCGTGGTGCCCCTGATGGGCCTCATGGAG
AGCATTGCGGTGGCCAAAGCCTTCGCATCTCAGGATAATTACCGCATCGATGCCAACCAG
GAGCTGCTGGCCATCGGTCTCACCAACATGTTGGGCTCCCTCGTCTCCTCCTACCCGGTC
ACAGGCAGCTTTGGACGGACAGCCGTGAACGCTCAGTCGGGGGTGTGCACCCCGGCGGGG
GGCCTGGTGACGGGAGTGCTGGTGCTGCTGTCTCTGGACTACCTGACCTCACTGTTCTAC
TACATCCCCAAGTCTGCCCTGGCTGCCGTCATCATCATGGCCGTGGCCCCGCTGTTCGAC
ACCAAGATCTTCAGGACGCTCTGGCGTGTTAAGAGGCTGGACCTGCTGCCCCTGTGCGTG
ACCTTCCTGCTGTGCTTCTGGGAGGTGCAGTACGGCATCCTGGCCGGGGCCCTGGTGTCT
CTGCTCATGCTCCTGCACTCTGCAGCCAGGCCTGAGACCAAGGTGTCAGAGGGGCCGGTT
CTGGTCCTGCAGCCGGCCAGCGGCCTGTCCTTCCCTGCCATGGAGGCTCTGCGGGAGGAG
ATCCTAAGCCGGGCCCTGGAAGTGTCCCCGCCACGCTGCCTGGTCCTGGAGTGCACCCAT
GTCTGCAGCATCGACTACACTGTGGTGCTGGGACTCGGCGAGCTCCTCCAGGACTTCCAG
AAGCAGGGCGTCGCCCTGGCCTTTGTGGGCCTGCAGGTCCCCGTTCTCCGTGTCCTGCTG
TCCGCTGACCTGAAGGGGTTCCAGTACTTCTCTACCCTGGAAGAAGCAGAGAAGCACCTG
AGGCAGGAGCCAGGGACCCAGCCCTACAACATCAGAGAAGACTCCATTCTGGACCAAAAG
GTTGCCCTGCTCAAGGCATAA
Protein Properties
Number of Residues 606
Molecular Weight 65298.305
Theoretical pI 7.315
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium-independent sulfate anion transporter
MPSSVTALGQARSSGPGMAPSACCCSPAALQRRLPILAWLPSYSLQWLKMDFVAGLSVGL
TAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEP
AYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIP
RPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLV
WAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT
EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPV
TGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFD
TKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSLLMLLHSAARPETKVSEGPV
LVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQ
KQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK
VALLKA
GenBank ID Protein 29243004
UniProtKB/Swiss-Prot ID Q86WA9
UniProtKB/Swiss-Prot Entry Name S2611_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ544073
GeneCard ID SLC26A11
GenAtlas ID SLC26A11
HGNC ID HGNC:14471
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743 ]
  3. Lohi H, Kujala M, Kerkela E, Saarialho-Kere U, Kestila M, Kere J: Mapping of five new putative anion transporter genes in human and characterization of SLC26A6, a candidate gene for pancreatic anion exchanger. Genomics. 2000 Nov 15;70(1):102-12. [PubMed:11087667 ]
  4. Vincourt JB, Jullien D, Amalric F, Girard JP: Molecular and functional characterization of SLC26A11, a sodium-independent sulfate transporter from high endothelial venules. FASEB J. 2003 May;17(8):890-2. Epub 2003 Mar 5. [PubMed:12626430 ]