You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05474
Secondary Accession Numbers
  • 11073
Name Solute carrier family 2, facilitated glucose transporter member 2
Synonyms
  1. GLUT-2
  2. Glucose transporter type 2, liver
Gene Name SLC2A2
Protein Type Enzyme
Biological Properties
General Function Involved in glucose transmembrane transporter activity
Specific Function Facilitative glucose transporter. This isoform likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell. May also participate with the Na(+)/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney.
Pathways
  • Carbohydrate digestion and absorption
  • Fanconi-bickel syndrome
  • Fructose-1,6-diphosphatase deficiency
  • Glibenclamide Action Pathway
  • Gliclazide Action Pathway
  • Gluconeogenesis
  • Glucose-Alanine Cycle
  • Glycogen Storage Disease Type 1A (GSD1A) or Von Gierke Disease
  • Glycogenosis, Type IA. Von gierke disease
  • Glycogenosis, Type IB
  • Glycogenosis, Type IC
  • Glycogenosis, Type VII. Tarui disease
  • Glycolysis
  • Insulin secretion
  • Lactose Degradation
  • Lactose Intolerance
  • Maturity onset diabetes of the young
  • Nateglinide Action Pathway
  • Pancreas Function
  • Phosphoenolpyruvate carboxykinase deficiency 1 (PEPCK1)
  • Repaglinide Action Pathway
  • Trehalose Degradation
  • Triosephosphate isomerase
  • Type II diabetes mellitus
  • Warburg Effect
Reactions Not Available
GO Classification
Biological Process
small molecule metabolic process
endocrine pancreas development
fructose transport
response to peptide hormone stimulus
response to glucose stimulus
energy reserve metabolic process
regulation of insulin secretion
carbohydrate metabolic process
Cellular Component
cytosol
basolateral plasma membrane
brush border membrane
integral to plasma membrane
endosome
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
glucose transmembrane transporter activity
carbohydrate transmembrane transporter activity
sugar transmembrane transporter activity
monosaccharide transmembrane transporter activity
hexose transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
Molecular Function
glucose transmembrane transporter activity
D-glucose transmembrane transporter activity
dehydroascorbic acid transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 3
Locus 3q26.1-q26.2
SNPs SLC2A2
Gene Sequence
>1575 bp
ATGACAGAAGATAAGGTCACTGGGACCCTGGTTTTCACTGTCATCACTGCTGTGCTGGGT
TCCTTCCAGTTTGGATATGACATTGGTGTGATCAATGCACCTCAACAGGTAATAATATCT
CACTATAGACATGTTTTGGGTGTTCCACTGGATGACCGAAAAGCTATCAACAACTATGTT
ATCAACAGTACAGATGAACTGCCCACAATCTCATACTCAATGAACCCAAAACCAACCCCT
TGGGCTGAGGAAGAGACTGTGGCAGCTGCTCAACTAATCACCATGCTCTGGTCCCTGTCT
GTATCCAGCTTTGCAGTTGGTGGAATGACTGCATCATTCTTTGGTGGGTGGCTTGGGGAC
ACACTTGGAAGAATCAAAGCCATGTTAGTAGCAAACATTCTGTCATTAGTTGGAGCTCTC
TTGATGGGGTTTTCAAAATTGGGACCATCTCATATACTTATAATTGCTGGAAGAAGCATA
TCAGGACTATATTGTGGGCTAATTTCAGGCCTGGTTCCTATGTATATCGGTGAAATTGCT
CCAACCGCTCTCAGGGGAGCACTTGGCACTTTTCATCAGCTGGCCATCGTCACGGGCATT
CTTATTAGTCAGATTATTGGTCTTGAATTTATCTTGGGCAATTATGATCTGTGGCACATC
CTGCTTGGCCTGTCTGGTGTGCGAGCCATCCTTCAGTCTCTGCTACTCTTTTTCTGTCCA
GAAAGCCCCAGATACCTTTACATCAAGTTAGATGAGGAAGTCAAAGCAAAACAAAGCTTG
AAAAGACTCAGAGGATATGATGATGTCACCAAAGATATTAATGAAATGAGAAAAGAAAGA
GAAGAAGCATCGAGTGAGCAGAAAGTCTCTATAATTCAGCTCTTCACCAATTCCAGCTAC
CGACAGCCTATTCTAGTGGCACTGATGCTGCATGTGGCTCAGCAATTTTCCGGAATCAAT
GGCATTTTTTACTACTCAACCAGCATTTTTCAGACGGCTGGTATCAGCAAACCTGTTTAT
GCAACCATTGGAGTTGGCGCTGTAAACATGGTTTTCACTGCTGTCTCTGTATTCCTTGTG
GAGAAGGCAGGGCGACGTTCTCTCTTTCTAATTGGAATGAGTGGGATGTTTGTTTGTGCC
ATCTTCATGTCAGTGGGACTTGTGCTGCTGAATAAGTTCTCTTGGATGAGTTATGTGAGC
ATGATAGCCATCTTCCTCTTTGTCAGCTTCTTTGAAATTGGGCCAGGCCCGATCCCCTGG
TTCATGGTGGCTGAGTTTTTCAGTCAAGGACCACGTCCTGCTGCTTTAGCAATAGCTGCA
TTCAGCAATTGGACCTGCAATTTCATTGTAGCTCTGTGTTTCCAGTACATTGCGGACTTC
TGTGGACCTTATGTGTTTTTCCTCTTTGCTGGAGTGCTCCTGGCCTTTACCCTGTTCACA
TTTTTTAAAGTTCCAGAAACCAAAGGAAAGTCTTTTGAGGAAATTGCTGCAGAATTCCAA
AAGAAGAGTGGCTCAGCCCACAGGCCAAAAGCTGCTGTAGAAATGAAATTCCTAGGAGCT
ACAGAGACTGTGTAA
Protein Properties
Number of Residues 524
Molecular Weight 57488.955
Theoretical pI 7.976
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Solute carrier family 2, facilitated glucose transporter member 2
MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYV
INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGD
TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA
PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP
ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSY
RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV
EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT
FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P11168
UniProtKB/Swiss-Prot Entry Name GTR2_HUMAN
PDB IDs Not Available
GenBank Gene ID J03810
GeneCard ID SLC2A2
GenAtlas ID SLC2A2
HGNC ID HGNC:11006
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Fukumoto H, Seino S, Imura H, Seino Y, Eddy RL, Fukushima Y, Byers MG, Shows TB, Bell GI: Sequence, tissue distribution, and chromosomal localization of mRNA encoding a human glucose transporter-like protein. Proc Natl Acad Sci U S A. 1988 Aug;85(15):5434-8. [PubMed:3399500 ]
  3. Matsubara A, Tanizawa Y, Matsutani A, Kaneko T, Kaku K: Sequence variations of the pancreatic islet/liver glucose transporter (GLUT2) gene in Japanese subjects with noninsulin dependent diabetes mellitus. J Clin Endocrinol Metab. 1995 Nov;80(11):3131-5. [PubMed:7593414 ]
  4. Tanizawa Y, Riggs AC, Chiu KC, Janssen RC, Bell DS, Go RP, Roseman JM, Acton RT, Permutt MA: Variability of the pancreatic islet beta cell/liver (GLUT 2) glucose transporter gene in NIDDM patients. Diabetologia. 1994 Apr;37(4):420-7. [PubMed:8063045 ]
  5. Mueckler M, Kruse M, Strube M, Riggs AC, Chiu KC, Permutt MA: A mutation in the Glut2 glucose transporter gene of a diabetic patient abolishes transport activity. J Biol Chem. 1994 Jul 8;269(27):17765-7. [PubMed:8027028 ]
  6. Burwinkel B, Sanjad SA, Al-Sabban E, Al-Abbad A, Kilimann MW: A mutation in GLUT2, not in phosphorylase kinase subunits, in hepato-renal glycogenosis with Fanconi syndrome and low phosphorylase kinase activity. Hum Genet. 1999 Sep;105(3):240-3. [PubMed:10987651 ]
  7. Sakamoto O, Ogawa E, Ohura T, Igarashi Y, Matsubara Y, Narisawa K, Iinuma K: Mutation analysis of the GLUT2 gene in patients with Fanconi-Bickel syndrome. Pediatr Res. 2000 Nov;48(5):586-9. [PubMed:11044475 ]