Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07320
Secondary Accession Numbers
  • 12942
Name Lipid phosphate phosphatase-related protein type 5
Synonyms
  1. PRG-5
  2. Phosphatidic acid phosphatase 2d
  3. Plasticity-related gene 5 protein
Gene Name LPPR5
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
catalytic activity
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 1p21.3
SNPs LPPR5
Gene Sequence
>966 bp
ATGCCCCTGCTGCCCGCGGCGCTCACCAGCAGCATGCTCTATTTCCAGATGGTGATCATG
GCAGGGACGGTGATGCTGGCGTACTACTTCGAGTATACGGACACGTTCACCGTGAACGTG
CAGGGCTTCTTCTGCCACGACAGCGCCTACCGCAAACCCTACCCGGGCCCGGAGGACAGC
AGCGCCGTGCCCCCCGTGCTCCTCTACTCGCTGGCCGCCGGGGTCCCCGTGCTCGTGATA
ATAGTTGGAGAAACTGCTGTCTTTTGCCTACAACTAGCCACAAGGGATTTTGAAAACCAG
GAAAAAACTATTTTAACTGGAGACTGTTGCTATATAAACCCGCTGGTGCGCCGAACTGTC
CGATTTCTTGGAATTTATACATTTGGACTGTTTGCTACAGATATCTTTGTAAATGCTGGA
CAAGTAGTCACAGGAAATCTGGCCCCACATTTCCTTGCCCTGTGTAAGCCCAATTATACA
GCACTTGGATGTCAGCAGTATACACAATTCATCAGTGGGGAAGAGGCCTGTACTGGCAAC
CCAGATCTCATCATGAGAGCCCGAAAAACCTTTCCATCCAAAGAAGCAGCTCTCAGTGTC
TATGCAGCTATGTATCTGACCATGTACATCACCAACACAATCAAAGCCAAGGGAACCAGA
CTTGCTAAGCCAGTTCTATGCTTGGGCTTAATGTGTTTGGCATTTCTTACTGGACTCAAC
AGAGTAGCAGAATATCGAAATCATTGGTCAGATGTTATAGCAGGCTTTCTGGTTGGAATA
TCTATAGCAGTATTTCTGGTTGTGTGCGTGGTGAATAATTTCAAAGGGAGACAAGCAGAA
AATGAGCATATACACATGGATAATCTGGCACAGATGCCAATGATCAGCATTCCTCGAGTA
GAAAGTCCTTTGGAAAAGGTAACATCTGTACAGAACCACATCACTGCCTTCGCAGAAGTC
ACATGA
Protein Properties
Number of Residues 321
Molecular Weight 35427.1
Theoretical pI 7.04
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 10-30
  • 62-82
  • 122-142
  • 196-213
  • 225-245
  • 252-272
Protein Sequence
>Lipid phosphate phosphatase-related protein type 5
MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS
SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV
RFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN
PDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLN
RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRV
ESPLEKVTSVQNHITAFAEVT
GenBank ID Protein 82659094
UniProtKB/Swiss-Prot ID Q32ZL2
UniProtKB/Swiss-Prot Entry Name LPPR5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001037317.1
GeneCard ID LPPR5
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Sun L, Gu S, Sun Y, Zheng D, Wu Q, Li X, Dai J, Dai J, Ji C, Xie Y, Mao Y: Cloning and characterization of a novel human phosphatidic acid phosphatase type 2, PAP2d, with two different transcripts PAP2d_v1 and PAP2d_v2. Mol Cell Biochem. 2005 Apr;272(1-2):91-6. [PubMed:16010976 ]