You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07405
Secondary Accession Numbers
  • 13079
Name Putative uncharacterized protein PGD
Synonyms
  1. SubName: cDNA FLJ51182, highly similar to 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)
Gene Name PGD
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Not Available
Pathways
  • Glucose-6-phosphate dehydrogenase deficiency
  • Pentose Phosphate Pathway
  • Ribose-5-phosphate isomerase deficiency
  • Transaldolase deficiency
Reactions Not Available
GO Classification
Function
binding
nucleotide binding
catalytic activity
oxidoreductase activity, acting on the ch-oh group of donors, nad or nadp as acceptor
nadp or nadph binding
coenzyme binding
cofactor binding
phosphogluconate dehydrogenase (decarboxylating) activity
oxidoreductase activity, acting on ch-oh group of donors
oxidoreductase activity
Process
metabolic process
pentose-phosphate shunt
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
oxidation reduction
glucose catabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.3-p36.13
SNPs PGD
Gene Sequence
>870 bp
ATGATTTCATCGAGAAATTGGTACCATTGTTGGATACTGGTGACATCATCATTGACGGAG
GAAATTCTGAATATAGGGACACCACAAGACGGTGCCGAGACCTCAAGGCCAAGGGAATTT
TATTTGTGGGGAGCGGAGTCAGTGGTGGAGAGGAAGGGGCCCGGTATGGCCCATCGCTCA
TGCCAGGAGGGAACAAAGAAGGGCACAGGGAAGTGGACCGCCATCTCCGCCCTGGAATAC
GGCGTACCCGTCACCCTCATTGGAGAAGCTGTCTTTGCTCGGTGCTTATCATCTCTGAAG
GATGAGAGAATTCAAGCTAGCAAAAAGCTGAAGGGTCCCCAGAAGTTCCAGTTTGATGGT
GATAAGAAATCATTCCTGGAGGACATTCGGAAGGCACTCTACGCTTCCAAGATCATCTCT
TACGCTCAAGGCTTTATGCTGCTAAGGCAGGCAGCCACCGAGTTTGGCTGGACTCTCAAT
TATGGTGGCATCGCCCTGATGTGGAGAGGGGGCTGCATCATTAGAAGTGTATTCCTAGGA
AAGATAAAGGATGCATTTGATCGAAACCCGGAACTTCAGAACCTCCTACTGGACGACTTC
TTTAAGTCAGCTGTTGAAAACTGCCAGGACTCCTGGCGGCGGGCAGTCAGCACTGGGGTC
CAGGCTGGCATTCCCATGCCCTGTTTTACCACTGCCCTCTCCTTCTATGACGGGTACAGA
CATGAGATGCTTCCAGCCAGCCTCATCCAGGCTCAGCGGGATTACTTCGGGGCTCACACC
TATGAACTCTTGGCCAAACCAGGGCAGTTTATCCACACCAACTGGACAGGCCATGGTGGC
ACCGTGTCATCCTCGTCATACAATGCCTGA
Protein Properties
Number of Residues 289
Molecular Weight 32311.5
Theoretical pI 8.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Putative uncharacterized protein PGD
MISSRNWYHCWILVTSSLTEEILNIGTPQDGAETSRPREFYLWGAESVVERKGPGMAHRS
CQEGTKKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDG
DKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLG
KIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYR
HEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
GenBank ID Protein 194384114
UniProtKB/Swiss-Prot ID A9Z1X1
UniProtKB/Swiss-Prot Entry Name A9Z1X1_HUMAN
PDB IDs
GenBank Gene ID AK303898
GeneCard ID PGD
GenAtlas ID PGD
HGNC ID HGNC:8891
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]