Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07572
Secondary Accession Numbers
  • 13280
Name C-C motif chemokine 28
Synonyms
  1. MEC
  2. Mucosae-associated epithelial chemokine
  3. Protein CCK1
  4. Small-inducible cytokine A28
Gene Name CCL28
Protein Type Unknown
Biological Properties
General Function Involved in chemokine activity
Specific Function Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
cytokine activity
chemokine activity
binding
protein binding
receptor binding
Process
immune system process
immune response
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:5
Locus 5p12
SNPs CCL28
Gene Sequence
>384 bp
ATGCAGCAGAGAGGACTCGCCATCGTGGCCTTGGCTGTCTGTGCGGCCCTACATGCCTCA
GAAGCCATACTTCCCATTGCCTCCAGCTGTTGCACGGAGGTTTCACATCATATTTCCAGA
AGGCTCCTGGAAAGAGTGAATATGTGTCGCATCCAGAGAGCTGATGGGGATTGTGACTTG
GCTGCTGTCATCCTTCATGTCAAGCGCAGAAGAATCTGTGTCAGCCCGCACAACCATACT
GTTAAGCAGTGGATGAAAGTGCAAGCTGCCAAGAAAAATGGTAAAGGAAATGTTTGCCAC
AGGAAGAAACACCATGGCAAGAGGAACAGTAACAGGGCACATCAGGGGAAACACGAAACA
TACGGCCATAAAACTCCTTATTAG
Protein Properties
Number of Residues 127
Molecular Weight 14279.5
Theoretical pI 10.88
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions
  • None
Protein Sequence
>C-C motif chemokine 28
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL
AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET
YGHKTPY
GenBank ID Protein 12002127
UniProtKB/Swiss-Prot ID Q9NRJ3
UniProtKB/Swiss-Prot Entry Name CCL28_HUMAN
PDB IDs Not Available
GenBank Gene ID AF110384
GeneCard ID CCL28
GenAtlas ID CCL28
HGNC ID HGNC:17700
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Wang W, Soto H, Oldham ER, Buchanan ME, Homey B, Catron D, Jenkins N, Copeland NG, Gilbert DJ, Nguyen N, Abrams J, Kershenovich D, Smith K, McClanahan T, Vicari AP, Zlotnik A: Identification of a novel chemokine (CCL28), which binds CCR10 (GPR2). J Biol Chem. 2000 Jul 21;275(29):22313-23. [PubMed:10781587 ]
  3. Pan J, Kunkel EJ, Gosslar U, Lazarus N, Langdon P, Broadwell K, Vierra MA, Genovese MC, Butcher EC, Soler D: A novel chemokine ligand for CCR10 and CCR3 expressed by epithelial cells in mucosal tissues. J Immunol. 2000 Sep 15;165(6):2943-9. [PubMed:10975800 ]