You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07604
Secondary Accession Numbers
  • 13313
Name Claudin-20
Synonyms Not Available
Gene Name CLDN20
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell-cell junction
occluding junction
tight junction
membrane
cell part
membrane part
plasma membrane part
cell junction
Function
structural molecule activity
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location Chromosome:6
Locus 6q25
SNPs CLDN20
Gene Sequence
>660 bp
ATGGCCTCAGCAGGACTCCAGCTCCTTGCTTTCATCCTGGCCTTATCTGGGGTCTCTGGA
GTGCTCACAGCCACTCTGCTGCCCAACTGGAAGGTGAATGTGGATGTGGACTCCAACATC
ATAACAGCCATTGTACAGCTGCACGGGCTCTGGATGGACTGTACGTGGTACAGCACTGGG
ATGTTCAGCTGTGCCCTGAAACACTCCATTCTGTCCCTCCCCATCCACGTGCAGGCTGCG
AGAGCCACCATGGTCCTGGCGTGTGTTCTGTCTGCTTTGGGGATCTGCACTTCCACAGTA
GGAATGAAATGTACTCGCTTAGGAGGGGACAGAGAAACCAAGAGCCATGCTTCCTTTGCT
GGAGGAGTCTGTTTCATGTCTGCAGGAATCTCTAGTTTAATCTCGACAGTGTGGTACACA
AAGGAGATCATAGCAAACTTTCTGGATCTGACAGTTCCAGAAAGCAACAAACATGAACCT
GGAGGAGCTATCTATATCGGATTCATTTCTGCAATGCTGTTGTTTATCTCTGGCATGATT
TTCTGCACCTCCTGTATAAAAAGGAATCCAGAAGCTAGACTCGACCCACCCACACAGCAG
CCTATCTCTAACACACAGCTCGAGAACAATTCCACACACAATCTGAAGGATTATGTGTAA
Protein Properties
Number of Residues 219
Molecular Weight 23515.2
Theoretical pI 7.41
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 8-28
  • 82-102
  • 119-139
  • 161-181
Protein Sequence
>Claudin-20
MASAGLQLLAFILALSGVSGVLTATLLPNWKVNVDVDSNIITAIVQLHGLWMDCTWYSTG
MFSCALKHSILSLPIHVQAARATMVLACVLSALGICTSTVGMKCTRLGGDRETKSHASFA
GGVCFMSAGISSLISTVWYTKEIIANFLDLTVPESNKHEPGGAIYIGFISAMLLFISGMI
FCTSCIKRNPEARLDPPTQQPISNTQLENNSTHNLKDYV
GenBank ID Protein 56204606
UniProtKB/Swiss-Prot ID P56880
UniProtKB/Swiss-Prot Entry Name CLD20_HUMAN
PDB IDs Not Available
GenBank Gene ID AL139101
GeneCard ID CLDN20
GenAtlas ID CLDN20
HGNC ID HGNC:2042
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]