You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07610
Secondary Accession Numbers
  • 13319
Name Claudin-9
Synonyms Not Available
Gene Name CLDN9
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell-cell junction
occluding junction
tight junction
membrane
cell part
membrane part
plasma membrane part
cell junction
Function
structural molecule activity
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location Chromosome:1
Locus 16p13.3
SNPs CLDN9
Gene Sequence
>654 bp
ATGGCTTCGACCGGCTTAGAACTGCTGGGCATGACCCTGGCTGTGCTGGGCTGGCTGGGG
ACCCTGGTGTCCTGCGCCCTGCCCCTGTGGAAGGTGACCGCCTTCATCGGCAACAGCATC
GTGGTGGCCCAGGTGGTGTGGGAGGGCCTGTGGATGTCCTGCGTGGTGCAGAGCACGGGC
CAGATGCAGTGCAAGGTGTACGACTCACTGCTGGCTCTGCCGCAGGACCTGCAGGCCGCA
CGTGCCCTCTGTGTCATTGCCCTCCTGCTGGCCCTGCTTGGCCTCCTGGTGGCCATCACA
GGTGCCCAGTGTACCACGTGTGTGGAGGACGAAGGTGCCAAGGCCCGTATCGTGCTCACC
GCGGGGGTCATCCTCCTCCTCGCCGGCATCCTGGTGCTCATCCCTGTGTGCTGGACGGCG
CACGCCATCATCCAGGACTTCTACAACCCCCTGGTGGCTGAGGCCCTCAAGCGGGAGCTG
GGGGCCTCCCTCTACCTGGGCTGGGCGGCGGCTGCACTGCTTATGCTGGGCGGGGGGCTC
CTCTGCTGCACGTGCCCCCCGCCCCAGGTCGAGCGGCCCCGCGGACCTCGGCTGGGCTAC
TCCATCCCCTCCCGCTCGGGTGCATCTGGACTGGACAAGAGGGACTACGTGTGA
Protein Properties
Number of Residues 217
Molecular Weight 22848.0
Theoretical pI 6.93
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 8-28
  • 82-102
  • 117-137
  • 160-180
Protein Sequence
>Claudin-9
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
AGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL
LCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
GenBank ID Protein 4128041
UniProtKB/Swiss-Prot ID O95484
UniProtKB/Swiss-Prot Entry Name CLD9_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ130941
GeneCard ID CLDN9
GenAtlas ID CLDN9
HGNC ID HGNC:2051
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]