You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07642
Secondary Accession Numbers
  • 13351
Name C-X-C chemokine receptor type 2
Synonyms
  1. CD182 antigen
  2. CDw128b
  3. CXC-R2
  4. CXCR-2
  5. GRO/MGSA receptor
  6. High affinity interleukin-8 receptor B
  7. IL-8 receptor type 2
  8. IL-8R B
Gene Name CXCR2
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
interleukin-8 receptor activity
receptor activity
transmembrane receptor activity
cytokine receptor activity
molecular transducer activity
signal transducer activity
Process
response to stimulus
response to chemical stimulus
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
chemotaxis
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2q35
SNPs CXCR2
Gene Sequence
>1083 bp
ATGGAAGATTTTAACATGGAGAGTGACAGCTTTGAAGATTTCTGGAAAGGTGAAGATCTT
AGTAATTACAGTTACAGCTCTACCCTGCCCCCTTTTCTACTAGATGCCGCCCCATGTGAA
CCAGAATCCCTGGAAATCAACAAGTATTTTGTGGTCATTATCTATGCCCTGGTATTCCTG
CTGAGCCTGCTGGGAAACTCCCTCGTGATGCTGGTCATCTTATACAGCAGGGTCGGCCGC
TCCGTCACTGATGTCTACCTGCTGAACCTAGCCTTGGCCGACCTACTCTTTGCCCTGACC
TTGCCCATCTGGGCCGCCTCCAAGGTGAATGGCTGGATTTTTGGCACATTCCTGTGCAAG
GTGGTCTCACTCCTGAAGGAAGTCAACTTCTATAGTGGCATCCTGCTACTGGCCTGCATC
AGTGTGGACCGTTACCTGGCCATTGTCCATGCCACACGCACACTGACCCAGAAGCGCTAC
TTGGTCAAATTCATATGTCTCAGCATCTGGGGTCTGTCCTTGCTCCTGGCCCTGCCTGTC
TTACTTTTCCGAAGGACCGTCTACTCATCCAATGTTAGCCCAGCCTGCTATGAGGACATG
GGCAACAATACAGCAAACTGGCGGATGCTGTTACGGATCCTGCCCCAGTCCTTTGGCTTC
ATCGTGCCACTGCTGATCATGCTGTTCTGCTACGGATTCACCCTGCGTACGCTGTTTAAG
GCCCACATGGGGCAGAAGCACCGGGCCATGCGGGTCATCTTTGCTGTCGTCCTCATCTTC
CTGCTCTGCTGGCTGCCCTACAACCTGGTCCTGCTGGCAGACACCCTCATGAGGACCCAG
GTGATCCAGGAGACCTGTGAGCGCCGCAATCACATCGACCGGGCTCTGGATGCCACCGAG
ATTCTGGGCATCCTTCACAGCTGCCTCAACCCCCTCATCTACGCCTTCATTGGCCAGAAG
TTTCGCCATGGACTCCTCAAGATTCTAGCTATACATGGCTTGATCAGCAAGGACTCCCTG
CCCAAAGACAGCAGGCCTTCCTTTGTTGGCTCTTCTTCAGGGCACACTTCCACTACTCTC
TAA
Protein Properties
Number of Residues 360
Molecular Weight 40758.7
Theoretical pI 8.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 49-75
  • 85-105
  • 121-142
  • 164-183
  • 209-231
  • 252-273
  • 295-315
Protein Sequence
>C-X-C chemokine receptor type 2
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
GenBank ID Protein 269973859
UniProtKB/Swiss-Prot ID P25025
UniProtKB/Swiss-Prot Entry Name CXCR2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001168298.1
GeneCard ID CXCR2
GenAtlas ID CXCR2
HGNC ID HGNC:6027
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Kato H, Tsuchiya N, Tokunaga K: Single nucleotide polymorphisms in the coding regions of human CXC-chemokine receptors CXCR1, CXCR2 and CXCR3. Genes Immun. 2000 Jun;1(5):330-7. [PubMed:11196695 ]
  3. Cerretti DP, Kozlosky CJ, Vanden Bos T, Nelson N, Gearing DP, Beckmann MP: Molecular characterization of receptors for human interleukin-8, GRO/melanoma growth-stimulatory activity and neutrophil activating peptide-2. Mol Immunol. 1993 Mar;30(4):359-67. [PubMed:8384312 ]
  4. Ahuja SK, Shetty A, Tiffany HL, Murphy PM: Comparison of the genomic organization and promoter function for human interleukin-8 receptors A and B. J Biol Chem. 1994 Oct 21;269(42):26381-9. [PubMed:7929358 ]
  5. Lee J, Horuk R, Rice GC, Bennett GL, Camerato T, Wood WI: Characterization of two high affinity human interleukin-8 receptors. J Biol Chem. 1992 Aug 15;267(23):16283-7. [PubMed:1379593 ]
  6. Murphy PM, Tiffany HL: Cloning of complementary DNA encoding a functional human interleukin-8 receptor. Science. 1991 Sep 13;253(5025):1280-3. [PubMed:1891716 ]
  7. Sprenger H, Lloyd AR, Lautens LL, Bonner TI, Kelvin DJ: Structure, genomic organization, and expression of the human interleukin-8 receptor B gene. J Biol Chem. 1994 Apr 15;269(15):11065-72. [PubMed:7512557 ]
  8. Mueller SG, White JR, Schraw WP, Lam V, Richmond A: Ligand-induced desensitization of the human CXC chemokine receptor-2 is modulated by multiple serine residues in the carboxyl-terminal domain of the receptor. J Biol Chem. 1997 Mar 28;272(13):8207-14. [PubMed:9079638 ]