You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07782
Secondary Accession Numbers
  • 13491
Name Vesicular integral-membrane protein VIP36
Synonyms
  1. Glycoprotein GP36b
  2. Lectin mannose-binding 2
Gene Name LMAN2
Protein Type Unknown
Biological Properties
General Function Involved in sugar binding
Specific Function Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Cellular Location
  1. Golgi apparatus membrane
  2. Endoplasmic reticulum membrane
  3. Single-pass type I membrane protein
  4. Single-pass type I membrane protein
  5. Single-pass membrane protein
  6. endoplasmic reticulum-Golgi intermediate compartment membrane
Gene Properties
Chromosome Location Chromosome:5
Locus 5q35.3
SNPs LMAN2
Gene Sequence
>1071 bp
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCT
GGGCTTCTCGGCCCCGGCCCTGGCCCCACTACACCTCTCTTTCTTCTTTTGTTGTTGGGG
TCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGC
ACTATGCTCACGAGCCAGTACGTACGTCTGACCCCTGACGAGCGCAGCAAAGAGGGCTCT
ATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGAC
CGCCTCGTGCCAGGGCCTGTGTTTGGAAGCAAAGATAACTTCCACGGCTTAGCCATCTTC
CTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCG
GGCTGCACGGCTGACTTCCGCAACCGCGATCACGACACCTTCCTGGCTGTGCGCTACTCC
CGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGC
GACCTGTCTGACAATCGTGACATCATCTCCATGAAGCTGTTCCAGCTGATGGTGGAGCAC
ACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGACAACGTGGACGACCCCACGGGGAACTTCCGCAGCGGGCCCCTGACGGGG
TGGCGGGTGTTCCTGCTGCTGCTGTGCGCTCTCCTGGGCATCGTTGTCTGCGCCGTGGTG
GGGGCCGTGGTGTTCCAGAAGCGGCAGGAGCGGAACAAGCGCTTCTACTGA
Protein Properties
Number of Residues 356
Molecular Weight 40228.4
Theoretical pI 6.95
Pfam Domain Function
Signals
  • 1-44
Transmembrane Regions
  • 323-345
Protein Sequence
>Vesicular integral-membrane protein VIP36
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSL
IKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKV
HGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCI
DITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLK
SPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVVFQKRQERNKRFY
GenBank ID Protein 62896777
UniProtKB/Swiss-Prot ID Q12907
UniProtKB/Swiss-Prot Entry Name LMAN2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK222609
GeneCard ID LMAN2
GenAtlas ID LMAN2
HGNC ID HGNC:16986
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519 ]
  3. Fullekrug J, Scheiffele P, Simons K: VIP36 localisation to the early secretory pathway. J Cell Sci. 1999 Sep;112 ( Pt 17):2813-21. [PubMed:10444376 ]