You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07835
Secondary Accession Numbers
  • 13544
Name Sodium/potassium/calcium exchanger 5
Synonyms
  1. Na(+)/K(+)/Ca(2+)-exchange protein 5
  2. Solute carrier family 24 member 5
Gene Name SLC24A5
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Cation exchanger involved in pigmentation, possibly by participating in ion transport in melanosomes. Probably transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Melanosome
  2. Membrane
  3. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 15q21.1
SNPs SLC24A5
Gene Sequence
>1503 bp
ATGCAGACAAAAGGGGGCCAAACATGGGCGAGAAGGGCTCTGTTGCTCGGCATCCTGTGG
GCCACTGCACATCTGCCTCTCTCAGGGACCTCCCTGCCCCAACGTCTCCCAAGGGCCACA
GGAAATAGCACCCAATGTGTTATTTCTCCATCATCGGAGTTTCCCGAAGGGTTTTTCACG
AGACAGGAGCGCAGAGATGGAGGCATCATAATCTATTTCCTAATTATCGTTTACATGTTC
ATGGCCATATCTATTGTCTGTGATGAATACTTCCTACCCTCCCTGGAAATCATCAGTGAA
TCCCTTGGATTGTCTCAGGATGTTGCAGGCACAACTTTCATGGCAGCGGGCAGTTCAGCT
CCTGAATTAGTTACTGCTTTCCTAGGTGTATTTATCACAAAGGGAGATATTGGCATTAGC
ACCATCCTTGGATCTGCAATTTATAATCTCCTTGGCATCTGTGCTGCCTGTGGTTTGCTA
TCTAATACGGTCTCAACACTATCATGTTGGCCCCTATTCAGAGACTGTGCAGCGTACACA
ATTAGTGCAGCAGCAGTTCTTGGTATAATATATGACAACCAAGTTTACTGGTATGAAGGG
GCTTTACTGCTTTTGATATATGGATTGTATGTTTTGGTGCTGTGTTTTGACATTAAAATT
AACCAATATATTATAAAGAAATGCAGTCCTTGCTGCGCCTGTCTTGCCAAAGCTATGGAG
AGAAGTGAACAACAGCCACTGATGGGCTGGGAAGATGAAGGTCAACCATTCATTCGTCGG
CAATCAAGAACTGATAGTGGAATATTTTATGAAGATTCTGGCTACTCTCAGCTCTCTATA
AGTTTACATGGCCTTAGTCAGGTTTCTGAAGATCCACCAAGTGTTTTCAACATGCCTGAA
GCAGACTTAAAAAGAATTTTTTGGGTATTATCCCTTCCTATTATTACATTACTTTTTCTA
ACCACACCAGATTGTAGAAAAAAGTTTTGGAAAAACTACTTTGTGATAACCTTTTTCATG
TCTGCAATATGGATATCCGCATTTACATATATCCTGGTTTGGATGGTCACAATTACAGGG
GAAACACTAGAAATTCCCGATACAGTAATGGGCCTTACTTTATTAGCAGCAGGAACAAGC
ATACCAGACACAATTGCAAGTGTGTTGGTTGCAAGAAAAGGGAAAGGAGATATGGCTATG
TCTAACATCGTGGGATCCAATGTGTTTGATATGTTGTGCCTTGGTATTCCATGGTTTATT
AAAACTGCATTTATAAATGGATCAGCTCCTGCAGAAGTAAACAGCAGAGGACTAACTTAC
ATAACCATCTCTCTCAACATTTCAATTATTTTTCTTTTTTTAGCAGTTCACTTCAATGGC
TGGAAACTAGACAGAAAGTTGGGAATAGTCTGCCTATTATCATACTTGGGGCTTGCTACA
TTATCAGTTCTATATGAACTTGGAATTATTGGAAATAATAAAATAAGGGGCTGTGGAGGT
TGA
Protein Properties
Number of Residues 500
Molecular Weight 54887.6
Theoretical pI 5.83
Pfam Domain Function
Signals
  • 1-29
Transmembrane Regions
  • 67-87
  • 112-132
  • 137-157
  • 170-190
  • 196-216
  • 303-323
  • 334-354
  • 369-389
  • 400-420
  • 438-458
  • 469-489
Protein Sequence
>Sodium/potassium/calcium exchanger 5
MQTKGGQTWARRALLLGILWATAHLPLSGTSLPQRLPRATGNSTQCVISPSSEFPEGFFT
RQERRDGGIIIYFLIIVYMFMAISIVCDEYFLPSLEIISESLGLSQDVAGTTFMAAGSSA
PELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNTVSTLSCWPLFRDCAAYT
ISAAAVLGIIYDNQVYWYEGALLLLIYGLYVLVLCFDIKINQYIIKKCSPCCACLAKAME
RSEQQPLMGWEDEGQPFIRRQSRTDSGIFYEDSGYSQLSISLHGLSQVSEDPPSVFNMPE
ADLKRIFWVLSLPIITLLFLTTPDCRKKFWKNYFVITFFMSAIWISAFTYILVWMVTITG
ETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFDMLCLGIPWFI
KTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLAT
LSVLYELGIIGNNKIRGCGG
GenBank ID Protein 33341100
UniProtKB/Swiss-Prot ID Q71RS6
UniProtKB/Swiss-Prot Entry Name NCKX5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF348468
GeneCard ID SLC24A5
GenAtlas ID SLC24A5
HGNC ID HGNC:20611
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF: Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes. J Proteome Res. 2006 Nov;5(11):3135-44. [PubMed:17081065 ]
  3. Stokowski RP, Pant PV, Dadd T, Fereday A, Hinds DA, Jarman C, Filsell W, Ginger RS, Green MR, van der Ouderaa FJ, Cox DR: A genomewide association study of skin pigmentation in a South Asian population. Am J Hum Genet. 2007 Dec;81(6):1119-32. Epub 2007 Oct 15. [PubMed:17999355 ]
  4. Lamason RL, Mohideen MA, Mest JR, Wong AC, Norton HL, Aros MC, Jurynec MJ, Mao X, Humphreville VR, Humbert JE, Sinha S, Moore JL, Jagadeeswaran P, Zhao W, Ning G, Makalowska I, McKeigue PM, O'donnell D, Kittles R, Parra EJ, Mangini NJ, Grunwald DJ, Shriver MD, Canfield VA, Cheng KC: SLC24A5, a putative cation exchanger, affects pigmentation in zebrafish and humans. Science. 2005 Dec 16;310(5755):1782-6. [PubMed:16357253 ]