You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08005
Secondary Accession Numbers
  • 13716
Name Spectrin beta chain, brain 1
Synonyms
  1. Beta-II spectrin
  2. Fodrin beta chain
  3. Spectrin, non-erythroid beta chain 1
Gene Name SPTBN1
Protein Type Unknown
Biological Properties
General Function Involved in actin binding
Specific Function Fodrin, which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoskeletal part
spectrin
organelle part
intracellular organelle part
Function
binding
structural molecule activity
structural constituent of cytoskeleton
protein binding
cytoskeletal protein binding
actin binding
Cellular Location
  1. Peripheral membrane protein
  2. Cytoplasmic side
  3. Isoform 2:Cell membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 2p21
SNPs SPTBN1
Gene Sequence
>7095 bp
ATGACGACCACAGTAGCCACAGACTATGACAACATTGAGATCCAGCAGCAGTACAGTGAT
GTCAACAACCGCTGGGATGTCGACGACTGGGACAATGAGAACAGCTCTGCGCGGCTTTTT
GAGCGGTCCCGCATCAAGGCTCTGGCAGATGAGCGTGAAGCCGTGCAGAAGAAGACCTTC
ACCAAGTGGGTCAATTCCCACCTTGCCCGTGTGTCCTGCCGGATCACAGACCTGTACACT
GACCTTCGAGATGGACGGATGCTCATCAAGCTGCTGGAGGTCCTCTCTGGAGAGAGGCTG
CCTAAACCCACCAAGGGACGAATGCGCATCCACTGCTTAGAGAATGTGGACAAGGCCCTT
CAGTTCCTGAAGGAGCAGAGAGTCCATCTTGAGAACATGGGGTCCCATGACATCGTGGAT
GGAAACCACCGGCTGACCCTTGGCCTCATCTGGACCATCATCCTGCGCTTCCAGATCCAG
GATATCAGTGTGGAAACTGAAGACAACAAAGAGAAGAAATCTGCCAAGGATGCATTGCTG
TTGTGGTGCCAGATGAAGACAGCTGGGTACCCCAATGTCAACATTCACAATTTCACCACT
AGCTGGAGGGACGGCATGGCCTTCAATGCACTGATACACAAACACCGGCCTGACCTGATA
GATTTTGACAAACTAAAGAAATCTAACGCACACTACAACCTGCAGAATGCATTTAATCTG
GCAGAACAGCACCTCGGCCTCACTAAACTGTTGGACCCCGAAGACATCAGCGTGGACCAT
CCTGATGAGAAGTCCATAATCACTTATGTGGTGACTTATTACCACTACTTCTCTAAGATG
AAGGCCTTAGCTGTTGAAGGAAAACGAATTGGAAAGGTGCTTGACAATGCTATTGAAACA
GAAAAAATGATTGAAAAGTATGAATCACTTGCCTCTGACCTTCTGGAATGGATTGAACAA
ACCATCATCATTCTGAACAATCGCAAATTTGCCAATTCACTGGTCGGGGTTCAACAGCAG
CTTCAGGCATTCAACACTTACCGCACTGTGGAGAAACCACCCAAATTTACTGAGAAGGGG
AACTTGGAAGTGCTGCTCTTCACCATTCAGAGCAAGATGAGGGCCAACAACCAGAAGGTC
TACATGCCCCGGGAGGGGAAGCTCATCTCTGACATCAACAAGGCCTGGGAAAGACTGGAA
AAAGCGGAACACGAAAGAGAACTGGCTTTGCGGAATGAGCTCATAAGACAGGAGAAACTG
GAACAGCTCGCCCGCAGATTTGATCGCAAGGCAGCTATGAGGGAGACTTGGCTGAGCGAA
AACCAGCGTCTGGTGTCTCAGGACAACTTTGGGTTTGACCTTCCTGCAGTTGAGGCCGCC
ACAAAAAAGCACGAGGCCATTGAGACAGACATTGCCGCATACGAGGAGCGTGTGCAGGCT
GTGGTAGCCGTGGCCAGGGAGCTCGAGGCCGAGAATTACCACGACATCAAGCGCATCACA
GCGAGGAAGGACAATGTCATCCGGCTCTGGGAATACCTACTGGAACTGCTCAGGGCCCGG
AGACAGCGGCTCGAGATGAACCTGGGGCTGCAGAAGATATTCCAGGAAATGCTCTACATT
ATGGACTGGATGGATGAAATGAAGGTGCTAGTATTGTCTCAAGACTATGGCAAACACTTA
CTTGGTGTGGAAGACCTGTTACAGAAGCACACCCTGGTTGAAGCAGACATTGGCATCCAG
GCAGAGCGGGTGAGAGGTGTCAATGCCTCCGCCCAGAAGTTCGCAACAGACGGGGAAGGT
TACAAGCCCTGTGACCCCCAGGTGATCCGAGACCGCGTGGCCCACATGGAGTTCTGTTAT
CAAGAGCTTTGCCAGCTGGCGGCTGAGCGCAGGGCCCGTCTGGAAGAGTCCCGCCGCCTC
TGGAAGTTCTTCTGGGAGATGGCAGAAGAGGAAGGCTGGATACGGGAGAAGGAGAAGATC
CTGTCCTCGGACGATTACGGGAAAGACCTGACCAGCGTCATGCGCCTGCTCAGCAAGCAC
CGGGCGTTCGAGGACGAGATGAGCGGCCGCAGTGGCCACTTTGAGCAGGCCATCAAGGAA
GGCGAAGACATGATCGCGGAGGAGCACTTCGGGTCGGAGAAGATCCGTGAGAGGATCATT
TACATCCGGGAGCAGTGGGCCAACCTAGAGCAGCTCTCGGCCATTCGGAAGAAGCGCCTG
GAGGAGGCCTCCCTGCTGCACCAGTTCCAGGCAGATGCTGATGACATTGATGCCTGGATG
CTGGACATCCTCAAGATTGTCTCCAGCAGCGACGTGGGCCACGATGAGTATTCCACACAG
TCTCTGGTCAAGAAACACAAGGACGTGGCGGAAGAGATCGCCAATTACAGGCCCACCCTT
GACACGCTGCACGAACAAGCCAGCGCCCTCCCCCAGGAGCATGCCGAGTCTCCAGACGTG
AGGGGCAGGCTGTCGGGCATCGAGGAGCGGTATAAGGAGGTGGCAGAGCTGACGCGGCTG
CGGAAGCAGGCACTCCAGGACACTCTGGCCCTGTACAAGATGTTCAGCGAGGCTGATGCC
TGTGAGCTCTGGATCGACGAGAAGGAGCAGTGGCTCAACAACATGCAGATCCCAGAGAAG
CTGGAGGATCTGGAGGTCATCCAGCACAGATTTGAGAGCCTAGAACCAGAAATGAACAAC
CAGGCTTCCCGGGTTGCAGTGGTGAACCAGATTGCACGCCAGCTGATGCACAGCGGCCAC
CCAAGTGAGAAGGAAATCAAAGCCCAGCAGGACAAACTCAACACAAGGTGGAGCCAGTTC
AGAGAACTGGTTGACAGGAAGAAGGATGCCCTCCTGTCTGCCCTGAGCATCCAGAACTAC
CACCTCGAGTGCAATGAAACCAAATCCTGGATTCGGGAAAAGACCAAGGTCATCGAGTCC
ACCCAGGACCTGGGCAATGACCTGGCTGGCGTCATGGCCCTGCAGCGCAAGCTGACCGGC
ATGGAGCGGGACTTGGTGGCCATTGAGGCAAAGCTGAGTGACCTGCAGAAGGAGGCGGAG
AAGCTGGAGTCCGAGCACCCCGACCAGGCCCAGGCCATCCTGTCTCGGCTGGCCGAGATC
AGCGACGTGTGGGAGGAGATGAAGACCACCCTGAAAAACCGAGAGGCCTCCCTGGGAGAG
GCCAGCAAGCTGCAGCAGTTCCTACGGGACTTGGACGACTTCCAGTCCTGGCTCTCTAGG
ACCCAGACAGCGATCGCCTCGGAGGACATGCCAAACACCCTGACCGAGGCTGAGAAGCTG
CTCACGCAGCACGAGAACATCAAGAATGAGATCGACAACTACGAGGAGGACTACCAGAAG
ATGAGGGACATGGGCGAGATGGTCACCCAGGGGCAGACCGATGCCCAGTACATGTTTCTG
CGGCAGCGGCTGCAGGCCCTGGACACTGGATGGAACGAGCTCCACAAGATGTGGGAGAAC
AGACAAAATCTCCTATCCCAGTCACATGCCTACCAGCAGTTCCTCAGAGACACGAAGCAA
GCCGAAGCCTTTCTTAACAACCAGGAGTATGTTCTGGCTCACACTGAAATGCCTACCACC
TTGGAAGGAGCTGAAGCAGCAATTAAAAAGCAAGAGGACTTCATGACCACCATGGACGCC
AATGAGGAGAAGATCAATGCTGTGGTGGAGACTGGCCGGAGGCTGGTGAGCGATGGGAAC
ATCAACTCAGATCGCATCCAGGAGAAGGTGGACTCTATTGATGACAGACATAGGAAGAAT
CGTGAGACAGCCAGTGAACTTTTGATGAGGTTGAAGGACAACAGGGATCTACAGAAATTC
CTGCAAGATTGTCAAGAGCTGTCTCTCTGGATCAATGAGAAGATGCTCACAGCCCAGGAC
ATGTCTTACGATGAAGCCAGAAATCTGCACAGTAAATGGTTGAAGCATCAAGCATTTATG
GCAGAACTTGCATCCAACAAAGAATGGCTTGACAAAATCGAGAAGGAAGGAATGCAGCTC
ATTTCAGAAAAGCCTGAGACGGAAGCTGTGGTGAAGGAGAAACTCACTGGTTTACATAAA
ATGTGGGAAGTCCTTGAATCCACTACCCAGACAAAGGCCCAGCGGCTCTTTGATGCAAAC
AAGGCCGAACTTTTCACCCAGAGCTGTGCAGATCTAGACAAATGGCTGCACGGCCTGGAG
AGTCAGATTCAGTCTGATGACTATGGCAAACACCTGACCAGTGTCAATATCCTGCTGAAA
AAGCAACAGATGCTGGAGAATCAGATGGAAGTGCGGAAGAAGGAGATCGAAGAGCTCCAA
AGCCAAGCCCAGGCCCTGAGTCAGGAAGGGAAGAGCACCGACGAGGTAGACAGCAAGCGC
CTCACCGTGCAGACCAAGTTCATGGAGTTGCTGGAGCCCTTGAACGAGAGGAAGCATAAC
CTGCTGGCCTCCAAAGAGATCCATCAGTTCAACAGGGATGTGGAGGACGAGATCTTGTGG
GTTGGAGAGAGGATGCCTTTGGCAACTTCCACGGATCATGGCCACAACCTCCAGACTGTG
CAGCTGTTAATAAAGAAAAATCAGACCCTCCAGAAAGAAATCCAGGGGCACCAGCCTCGC
ATTGACGACATCTTTGAGAGGAGCCAAAACATCGTCACTGACAGCAGCAGCCTCAGCGCT
GAGGCCATCAGACAGAGGCTTGCCGACCTGAAGCAGCTGTGGGGTCTCCTCATTGAGGAG
ACAGAGAAACGCCACAGGCGGCTGGAGGAGGCGCACAGGGCCCAGCAGTACTACTTTGAC
GCTGCTGAGGCCGAAGCCTGGATGAGCGAGCAGGAGCTGTACATGATGTCAGAGGAGAAG
GCCAAGGATGAGCAGAGTGCTGTCTCCATGTTGAAGAAGCACCAGATCTTAGAACAAGCT
GTGGAGGACTATGCAGAGACCGTGCATCAGCTCTCCAAGACCAGCCGGGCCCTGGTGGCC
GACAGCCATCCTGAAAGTGAGCGCATTAGCATGCGGCAGTCCAAAGTGGATAAACTGTAC
GCTGGTCTGAAAGACCTTGCTGAAGAGAGAAGAGGCAAGCTGGATGAGAGACACAGGTTA
TTCCAGCTCAACCGGGAGGTGGACGACCTGGAGCAGTGGATCGCTGAGAGGGAGGTGGTC
GCAGGGTCCCATGAACTGGGACAGGACTATGAGCATGTCACGATGTTACAAGAACGATTC
CGGGAGTTTGCCCGAGACACCGGGAACATTGGGCAGGAGCGCGTGGACACGGTCAATCAC
CTGGCAGATGAGCTCATCAACTCTGGACATTCAGATGCCGCCACCATCGCTGAATGGAAG
GATGGCCTCAATGAAGCCTGGGCCGACCTCCTGGAGCTCATTGACACAAGAACACAGATT
CTTGCCGCTTCCTATGAACTGCACAAGTTTTACCACGATGCCAAGGAGATCTTTGGGCGT
ATACAGGACAAACACAAGAAACTCCCTGAGGAGCTTGGGAGAGATCAGAACACAGTGGAG
ACCTTACAGAGAATGCACACTACATTTGAGCATGACATCCAGGCTCTGGGCACACAGGTG
AGGCAGCTGCAGGAGGATGCAGCCCGCCTCCAGGCGGCCTATGCGGGTGACAAGGCCGAC
GATATCCAGAAGCGCGAGAACGAGGTCCTGGAAGCCTGGAAGTCCCTCCTGGACGCCTGT
GAGAGCCGCAGGGTGCGGCTGGTGGACACAGGGGACAAGTTCCGCTTCTTCAGCATGGTG
CGCGACCTCATGCTCTGGATGGAGGATGTCATCCGGCAGATCGAGGCCCAGGAGAAGCCA
AGGGATGTATCATCTGTTGAACTCTTAATGAATAATCATCAAGGCATCAAAGCTGAAATT
GATGCACGTAATGACAGTTTCACAACCTGCATTGAACTTGGGAAATCCCTGTTGGCGAGA
AAACACTATGCATCTGAGGAGATCAAGGAAAAATTACTGCAGTTGACGGAAAAGAGGAAA
GAAATGATCGACAAGTGGGAAGACCGATGGGAATGGTTAAGACTGATTCTGGAGGTCCAT
CAGTTCTCAAGAGACGCCAGTGTGGCCGAGGCCTGGCTGCTTGGACAGGAGCCGTACCTA
TCCAGCCGAGAGATAGGCCAGAGCGTGGACGAGGTGGAGAAGCTCATCAAGCGCCACGAG
GCATTTGAAAAGTCTGCAGCAACCTGGGATGAGAGGTTCTCTGCCCTGGAAAGGCTGACT
ACATTGGAGTTACTGGAAGTGCGCAGACAGCAAGAGGAAGAGGAGAGGAAGAGGCGGCCG
CCTTCTCCCGAGCCGAGCACGAAGGTTTCAGAGGAAGCCGAGTCCCAGCAGCAGTGGGAT
ACTTCAAAAGGAGAACAAGTTTCCCAAAACGGTTTGCCAGCTGAACAGGGATCTCCACGG
ATGGCAGAAACGGTGGACACAAGCGAAATGGTCAACGGCGCTACAGAACAAAGGACGAGC
TCTAAAGAGTCCAGCCCCATCCCCTCCCCGACCTCTGATCGTAAAGCCAAGACTGCCCTC
CCAGCCCAGAGTGCCGCCACCTTACCAGCCAGAACCCAGGAGACACCTTCGGCCCAGATG
GAAGGCTTCCTCAATCGGAAACACGAGTGGGAGGCCCACAATAAGAAAGCCTCAAGCAGG
TCCTGGCACAATGTTTATTGTGTCATAAATAACCAAGAAATGGGTTTCTACAAAGATGCA
AAGACTGCTGCTTCTGGAATTCCCTACCACAGCGAGGTCCCTGTGAGTTTGAAAGAAGCT
GTCTGCGAAGTGGCCCTTGATTACAAAAAGAAGAAACACGTATTCAAGCTAAGACTAAAT
GATGGCAATGAGTACCTCTTCCAAGCCAAAGACGATGAGGAAATGAACACATGGATCCAG
GCTATCTCTTCCGCCATCTCCTCTGATAAACACGAGGTGTCTGCCAGCACCCAGAGCACG
CCAGCATCCAGCCGCGCGCAGACCCTCCCCACCAGCGTCGTCACCATCACCAGCGAGTCC
AGTCCCGGCAAGCGGGAAAAGGACAAAGAGAAAGACAAAGAGAAGCGGTTCAGCCTTTTT
GGCAAAAAGAAATGA
Protein Properties
Number of Residues 2364
Molecular Weight 274607.0
Theoretical pI 5.26
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Spectrin beta chain, brain 1
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERII
YIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQ
SLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN
RETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDAN
KAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQ
SQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILW
VGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSA
EAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEK
AKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLY
AGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERF
REFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQI
LAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQV
RQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMV
RDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLAR
KHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYL
SSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP
PSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTS
SKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSR
SWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLN
DGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSES
SPGKREKDKEKDKEKRFSLFGKKK
GenBank ID Protein 338443
UniProtKB/Swiss-Prot ID Q01082
UniProtKB/Swiss-Prot Entry Name SPTB2_HUMAN
PDB IDs Not Available
GenBank Gene ID M96803
GeneCard ID SPTBN1
GenAtlas ID SPTBN1
HGNC ID HGNC:11275
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  7. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  8. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  9. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  10. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  11. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  12. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  13. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  14. Kim JE, Tannenbaum SR, White FM: Global phosphoproteome of HT-29 human colon adenocarcinoma cells. J Proteome Res. 2005 Jul-Aug;4(4):1339-46. [PubMed:16083285 ]
  15. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  16. Hu RJ, Watanabe M, Bennett V: Characterization of human brain cDNA encoding the general isoform of beta-spectrin. J Biol Chem. 1992 Sep 15;267(26):18715-22. [PubMed:1527002 ]
  17. Chen Y, Yu P, Lu D, Tagle DA, Cai T: A novel isoform of beta-spectrin II localizes to cerebellar Purkinje-cell bodies and interacts with neurofibromatosis type 2 gene product schwannomin. J Mol Neurosci. 2001 Aug;17(1):59-70. [PubMed:11665863 ]
  18. Chang JG, Scarpa A, Eddy RL, Byers MG, Harris AS, Morrow JS, Watkins P, Shows TB, Forget BG: Cloning of a portion of the chromosomal gene and cDNA for human beta-fodrin, the nonerythroid form of beta-spectrin. Genomics. 1993 Aug;17(2):287-93. [PubMed:8406479 ]
  19. Hayes NV, Scott C, Heerkens E, Ohanian V, Maggs AM, Pinder JC, Kordeli E, Baines AJ: Identification of a novel C-terminal variant of beta II spectrin: two isoforms of beta II spectrin have distinct intracellular locations and activities. J Cell Sci. 2000 Jun;113 ( Pt 11):2023-34. [PubMed:10806113 ]
  20. Mohler PJ, Yoon W, Bennett V: Ankyrin-B targets beta2-spectrin to an intracellular compartment in neonatal cardiomyocytes. J Biol Chem. 2004 Sep 17;279(38):40185-93. Epub 2004 Jul 19. [PubMed:15262991 ]
  21. Djinovic Carugo K, Banuelos S, Saraste M: Crystal structure of a calponin homology domain. Nat Struct Biol. 1997 Mar;4(3):175-9. [PubMed:9164454 ]
  22. Banuelos S, Saraste M, Djinovic Carugo K: Structural comparisons of calponin homology domains: implications for actin binding. Structure. 1998 Nov 15;6(11):1419-31. [PubMed:9817844 ]